Overview

  • Product name
  • Description
    Rabbit polyclonal to Dkk3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human Dkk3 aa 50-85 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    PQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAAKASSEV


    Database link: Q9UBP4

  • Positive control
    • Human lung carcinoma and rat buccal mucosa cancer tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab214360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function
    Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
  • Tissue specificity
    Highest expression in heart, brain, and spinal cord.
  • Sequence similarities
    Belongs to the dickkopf family.
  • Domain
    The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6.
  • Post-translational
    modifications
    N- and O-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Dickkopf 3 antibody
    • Dickkopf 3 homolog (Xenopus laevis) antibody
    • Dickkopf 3 homolog antibody
    • Dickkopf homolog 3 antibody
    • Dickkopf related protein 3 antibody
    • Dickkopf related protein 3 Precursor antibody
    • Dickkopf WNT signaling pathway inhibitor 3 antibody
    • Dickkopf, Xenopus, homolog of, 3 antibody
    • Dickkopf-3 antibody
    • Dickkopf-related protein 3 antibody
    • Dickkopf3 antibody
    • DKK 3 antibody
    • Dkk-3 antibody
    • DKK3 antibody
    • DKK3_HUMAN antibody
    • hDkk 3 antibody
    • hDkk-3 antibody
    • hDkk3 antibody
    • Regulated in glioma antibody
    • REIC antibody
    • RIG antibody
    • RIG-like 5-6 antibody
    • RIG-like 7-1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung carcinoma labeling Dkk3 with ab214360 at 1/100 dilution followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat buccal mucosa cancer labeling Dkk3 with ab214360 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab214360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up