Overview

  • Product name

  • Description

    Rabbit polyclonal to DLG5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse DLG5 aa 1724-1917. (Expressed in E.coli)
    Sequence:

    DSVSLAYQRVQKVDCTSLRPVLLLGPLLDVVKEMLVNEAPGKFCRCPLEV MKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITEKNRHCLLDIA PHAIERLHHMHIYPIVIFIRYKSAKHIKEQRDPVYLRDKVTQRHSKEQFE TAQKIDQEYSRYFTGVVQGGALSSICTQILAMVSQEQSKVLWIP


    Database link: E9Q9R9

  • Positive control

    • IHC-P: Mouse brain tissue. WB: Recombinant mouse DLG5 protein; PC-3 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231283 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 214 kDa.

Target

  • Function

    May play a role at the plasma membrane in the maintenance of the structure of epithelial cells and in the transmission of extracellular signals to the membrane and cytoskeleton.
  • Tissue specificity

    Highly expressed in the placenta and prostate. Expressed at a lower level in the thyroid, spinal cord, trachea, adrenal gland, skeletal muscle, pancreas, heart, brain, liver and kidney. A short splice product shows more limited expression, being absent from at least the brain.
  • Sequence similarities

    Belongs to the MAGUK family.
    Contains 1 CARD domain.
    Contains 1 guanylate kinase-like domain.
    Contains 4 PDZ (DHR) domains.
    Contains 1 SH3 domain.
  • Cellular localization

    Cell junction. Cell membrane. Localized at sites of cell-cell contact.
  • Information by UniProt
  • Database links

  • Alternative names

    • Discs large homolog 5 (Drosophila) antibody
    • Discs large homolog 5 antibody
    • Discs large protein LP DLG antibody
    • Discs large protein P dlg antibody
    • Discs large protein P-dlg antibody
    • Disks large homolog 5 antibody
    • DLG 5 antibody
    • DLG5 antibody
    • DLG5_HUMAN antibody
    • KIAA0583 antibody
    • Large type of P DLG antibody
    • LP DLG antibody
    • P DLG5 antibody
    • PDLG antibody
    • Placenta and prostate DLG antibody
    see all

Images

  • Anti-DLG5 antibody (ab231283) at 2 µg/ml + PC-3 (human prostate adenocarcinoma cell line) cell lysate.

    Predicted band size: 214 kDa

  • Anti-DLG5 antibody (ab231283) at 2 µg/ml + Recombinant mouse DLG5 protein.

    Predicted band size: 214 kDa

  • Formalin-fixed, paraffin-embedded mouse brain tissue stained for DLG5 using ab231283 at 20 µg/ml in immunohistochemical analysis.

References

ab231283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up