Overview

  • Product name

    Anti-DLK-1 antibody [9D8]
    See all DLK-1 primary antibodies
  • Description

    Mouse monoclonal [9D8] to DLK-1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DLK-1 aa 124-295.
    Sequence:

    CQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANS CTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTC LQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVH ELPVQQPEHRILKVSMKELNKK


    Database link: P80370

Properties

Applications

Our Abpromise guarantee covers the use of ab196543 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 41 kDa.

Target

  • Function

    May have a role in neuroendocrine differentiation.
  • Tissue specificity

    Found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. Found also in some forms of neuroendocrine lung tumor tissue.
  • Sequence similarities

    Contains 6 EGF-like domains.
  • Post-translational
    modifications

    N- and O-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adipocyte differentiation inhibitor protein antibody
    • Brevideltin antibody
    • Delta like 1 homolog antibody
    • Delta like homolog antibody
    • Delta like protein antibody
    • Delta1 antibody
    • DLK 1 antibody
    • DLK antibody
    • DLK-1 antibody
    • DLK1 antibody
    • DLK1_HUMAN antibody
    • FA 1 antibody
    • FA1 antibody
    • Fetal antigen 1 antibody
    • pG2 antibody
    • Preadipocyte factor 1 antibody
    • Pref 1 antibody
    • Pref antibody
    • Pref1 antibody
    • Protein delta homolog 1 antibody
    • Secredeltin antibody
    • ZOG antibody
    see all

References

ab196543 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (human Embryonal rhabdomyosarcoma cell line)
Gel Running Conditions
Reduced Denaturing (4-20% gel)
Loading amount
25 µg
Specification
human Embryonal rhabdomyosarcoma cell line
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 20°C

Abcam user community

Verified customer

Submitted May 28 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up