Overview

  • Product name
  • Description
    Rabbit polyclonal to DLL4
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DLL4 aa 168-345. (BC106950).
    Sequence:

    RYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYC QQPICLSGCHEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTP WQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATCSNSGQRSYTCTCRPGYT GVDCELELSECDSNPCRNGGSCKDQEDG


    Database link: Q9NR61

  • Positive control
    • Human fetal kidney and fetal lung lysates; Human fetal kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab176876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 74 kDa.

Target

  • Function
    Plays a role in the Notch signaling pathway. Activates Notch-1 and Notch-4.
  • Tissue specificity
    Expressed in vascular endothelium.
  • Sequence similarities
    Contains 1 DSL domain.
    Contains 8 EGF-like domains.
  • Domain
    The Delta-Serrate-Lag2 (DSL) domain is required for binding to the Notch receptor.
  • Post-translational
    modifications
    Ubiquitinated by MIB (MIB1 or MIB2), leading to its endocytosis and subsequent degradation.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • AOS6 antibody
    • Delta 4 antibody
    • delta 4 precursor antibody
    • Delta ligand 4 antibody
    • delta ligand 4 precursor antibody
    • Delta like 4 antibody
    • Delta like 4 homolog antibody
    • Delta like 4 protein antibody
    • Delta like canonical Notch ligand 4 antibody
    • Delta like protein 4 antibody
    • Delta-like 4 (Drosophila) antibody
    • Delta-like protein 4 antibody
    • Delta4 antibody
    • DLL 4 antibody
    • Dll4 antibody
    • DLL4_HUMAN antibody
    • Drosophila Delta homolog 4 antibody
    • hdelta2 antibody
    • Homeobox protein DLL-4 antibody
    • MGC126344 antibody
    • Notch ligand delta 2 antibody
    • Notch ligand DLL4 antibody
    • Notch ligand DLL4 precursor antibody
    • XDLL-4 antibody
    see all

Images

  • All lanes : Anti-DLL4 antibody (ab176876) at 1/500 dilution

    Lane 1 : Human fetal kidney lysate
    Lane 2 : Human fetal lung lysate

    Predicted band size: 74 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal kidney tissue labeling DLL4 with ab176876 at 1/100 dilution.

References

This product has been referenced in:
  • Verrienti A  et al. RET mutation and increased angiogenesis in medullary thyroid carcinomas. Endocr Relat Cancer 23:665-76 (2016). Read more (PubMed: 27402614) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up