Overview

  • Product name

  • Description

    Rabbit polyclonal to DLL4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DLL4 aa 455-523.
    Sequence:

    CHDLENGLMCTCPAGFSGRRCEVRTSIDACASSPCFNRATCYTDLSTDTF VCNCPYGFVGSRCEFPVGL


    Database link: Q9NR61

  • Positive control

    • IHC-P: Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Plays a role in the Notch signaling pathway. Activates Notch-1 and Notch-4.
  • Tissue specificity

    Expressed in vascular endothelium.
  • Sequence similarities

    Contains 1 DSL domain.
    Contains 8 EGF-like domains.
  • Domain

    The Delta-Serrate-Lag2 (DSL) domain is required for binding to the Notch receptor.
  • Post-translational
    modifications

    Ubiquitinated by MIB (MIB1 or MIB2), leading to its endocytosis and subsequent degradation.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AOS6 antibody
    • Delta 4 antibody
    • delta 4 precursor antibody
    • Delta ligand 4 antibody
    • delta ligand 4 precursor antibody
    • Delta like 4 antibody
    • Delta like 4 homolog antibody
    • Delta like 4 protein antibody
    • Delta like canonical Notch ligand 4 antibody
    • Delta like protein 4 antibody
    • Delta-like 4 (Drosophila) antibody
    • Delta-like protein 4 antibody
    • Delta4 antibody
    • DLL 4 antibody
    • Dll4 antibody
    • DLL4_HUMAN antibody
    • Drosophila Delta homolog 4 antibody
    • hdelta2 antibody
    • Homeobox protein DLL-4 antibody
    • MGC126344 antibody
    • Notch ligand delta 2 antibody
    • Notch ligand DLL4 antibody
    • Notch ligand DLL4 precursor antibody
    • XDLL-4 antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for DLL4 using ab223732 at 1/50 dilution in immunohistochemical analysis.

References

ab223732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up