Overview

  • Product name

    Anti-DLL4 antibody (Biotin)
    See all DLL4 primary antibodies
  • Description

    Rabbit polyclonal to DLL4 (Biotin)
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: WB, Sandwich ELISAmore details
  • Species reactivity


    Predicted to work with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DLL4 aa 27-524. Produced in HEK-293.
    Sequence:

    SGVFQLQLQEFINERGVLASGRPCEPGCRTFFRVCLKHFQAVVSPGPCTF GTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIEAWHAPG DDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICS DNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGC HEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGW GGLFCDQDLNYCTHHSPCKNGATCSNSGQRSYTCTCRPGYTGVDCELELS ECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCEHSTLSCADSPCFNGGS CRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNRGPSRMC RCRPGFTGTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCE VRTSIDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLP


    Database link: Q9NR61

  • Positive control

    • WB: Recombinant human DLL4 protein. sELISA: Recombinant human DLL4 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab245848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 74 kDa.
Sandwich ELISA Use a concentration of 0.25 - 1 µg/ml.

Target

  • Function

    Plays a role in the Notch signaling pathway. Activates Notch-1 and Notch-4.
  • Tissue specificity

    Expressed in vascular endothelium.
  • Sequence similarities

    Contains 1 DSL domain.
    Contains 8 EGF-like domains.
  • Domain

    The Delta-Serrate-Lag2 (DSL) domain is required for binding to the Notch receptor.
  • Post-translational
    modifications

    Ubiquitinated by MIB (MIB1 or MIB2), leading to its endocytosis and subsequent degradation.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AOS6 antibody
    • Delta 4 antibody
    • delta 4 precursor antibody
    • Delta ligand 4 antibody
    • delta ligand 4 precursor antibody
    • Delta like 4 antibody
    • Delta like 4 homolog antibody
    • Delta like 4 protein antibody
    • Delta like canonical Notch ligand 4 antibody
    • Delta like protein 4 antibody
    • Delta-like 4 (Drosophila) antibody
    • Delta-like protein 4 antibody
    • Delta4 antibody
    • DLL 4 antibody
    • Dll4 antibody
    • DLL4_HUMAN antibody
    • Drosophila Delta homolog 4 antibody
    • hdelta2 antibody
    • Homeobox protein DLL-4 antibody
    • MGC126344 antibody
    • Notch ligand delta 2 antibody
    • Notch ligand DLL4 antibody
    • Notch ligand DLL4 precursor antibody
    • XDLL-4 antibody
    see all

Images

  • To detect human DLL4 by Western Blot analysis ab245848 can be used at a concentration of 0.1 - 0.2 μg/ml.

    Used in conjunction with compatible secondary reagents the detection limit for recombinant human DLL4 is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.

    Lanes 1-11: 250, 125, 62.5, 31.25, 15.625, 7.8, 3.9, 1.95, 0.975, 0.4875 and 0.24 ng recombinant human DLL4 respectively.

    Reducing conditions.

  • To detect human DLL4 by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.25 – 1.0 μg/ml of ab245848 is required.

    This biotinylated polyclonal antibody, in conjunction with a capture antibody, allows the detection of at least 0.2 – 0.4 ng/well of recombinant human DLL4.

References

ab245848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up