Overview

  • Product name

  • Description

    Rabbit polyclonal to DLST
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human DLST aa 50-100. The exact sequence is proprietary. (NP_001924.2)
    Sequence:

    LTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLM W


    Database link: P36957

  • Positive control

    • HeLa, Jurkat, 293T and TCMK whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab187699 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 49 kDa.

Target

  • Function

    The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of 3 enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).
  • Pathway

    Amino-acid degradation; L-lysine degradation via saccharopine pathway; glutaryl-CoA from L-lysine: step 6/6.
  • Sequence similarities

    Belongs to the 2-oxoacid dehydrogenase family.
    Contains 1 lipoyl-binding domain.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2-oxoglutarate dehydrogenase complex component E2 antibody
    • Dihydrolipoamide S succinyltransferase (E2 component of 2 oxo glutarate complex) antibody
    • Dihydrolipoamide S succinyltransferase antibody
    • Dihydrolipoamide succinyltransferase component of 2 oxoglutarate dehydrogenase complex antibody
    • Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex antibody
    • Dihydrolipoyllysine residue succinyltransferase component of 2 oxoglutarate dehydrogenase complex antibody
    • Dihydrolipoyllysine residue succinyltransferase component of 2 oxoglutarate dehydrogenase complex mitochondrial antibody
    • Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex antibody
    • Dlst antibody
    • DLTS antibody
    • E2 antibody
    • E2K antibody
    • mitochondrial antibody
    • ODO2_HUMAN antibody
    • OGDC-E2 antibody
    see all

Images

  • Detection of DLST by Western Blot of Immunprecipitate.

    Lane 1: ab187699 at 1 µg/ml labeling DLST in Jurkat whole cell lysate immunoprecipitated using ab187699 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).

    Lane 2: Control IgG
    Detection: Chemiluminescence with exposure time of 3 seconds.

     

  • All lanes : Anti-DLST antibody (ab187699) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 cell lysate
    Lane 5 : NIH3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 49 kDa


    Exposure time: 30 seconds

References

This product has been referenced in:

  • Diaz-Muñoz MD  et al. The RNA-binding protein HuR is essential for the B cell antibody response. Nat Immunol 16:415-25 (2015). WB ; Mouse . Read more (PubMed: 25706746) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187699.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up