Overview

  • Product name

    Anti-Dlx1 antibody [OTI1E6]
    See all Dlx1 primary antibodies
  • Description

    Mouse monoclonal [OTI1E6] to Dlx1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human Dlx1 aa 1-255. (NP_835221) produced in E.coli.
    Sequence:

    MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGH SQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSR LEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQT QYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALA NGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQ QPQLM


    Database link: P56177-1

  • Positive control

    • IHC-P: Human adult brain and embryonic cerebellum tissue. WB: pCMV6-ENTRY Dlx1 cDNA transfected HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 27 kDa.
IHC-P 1/500.

Heat-induced epitope retrieval by 1 mM EDTA in 10 mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

Target

  • Function

    Likely to play a regulatory role in the development of the ventral forebrain. May play a role in craniofacial patterning and morphogenesis and may be involved in the early development of diencephalic subdivisions.
  • Sequence similarities

    Belongs to the distal-less homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DII B antibody
    • Distal less homeo box 1 antibody
    • Distal less homeobox 1 antibody
    • Distal-less homeobox gene 1a antibody
    • Dlx 1 antibody
    • Dlx antibody
    • Dlx1 antibody
    • Dlx1 distal-less homeobox 1 antibody
    • DLX1_HUMAN antibody
    • Homeo box protein DLX1 antibody
    • Homeobox protein DLX 1 antibody
    • Homeobox protein DLX-1 antibody
    • Homeobox protein Dlx1a antibody
    • Homeodomain transcription factor DLX1 antibody
    • MGC189409 antibody
    • OTTHUMP00000082494 antibody
    • OTTHUMP00000082497 antibody
    • OTTMUSP00000014202 antibody
    • RP23-419H3.3 antibody
    see all

Images

  • All lanes : Anti-Dlx1 antibody [OTI1E6] (ab236381) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY Dlx1 cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 27 kDa

  • Paraffin-embedded human adult brain tissue stained for Dlx1 with ab236381 at a 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human embryonic cerebellum tissue stained for Dlx1 with ab236381 at a 1/500 dilution in immunohistochemical analysis.

References

ab236381 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunoprecipitation
Sample
Human Cell lysate - whole cell (Cancer cell)
Total protein in input
30 µg
Immuno-precipitation step
Protein A/G
Specification
Cancer cell

Ms. Sakshi Goel

Verified customer

Submitted Aug 09 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up