Overview

  • Product name

  • Description

    Rabbit polyclonal to DMRTA1
  • Host species

    Rabbit
  • Specificity

    ab200640 detects endogenous levels of DMRTA1.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human DMRTA1 aa 205-250. The exact sequence is proprietary.
    Sequence:

    ATPAFEVFQQDYPEEKQEQKESKCESCQNGQEELISKSHQLYLGS


    Database link: Q5VZB9

  • Positive control

    • HEK293T, mouse Raw 264.7 and rat PC12 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab200640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 53 kDa.

Target

Images

  • All lanes : Anti-DMRTA1 antibody (ab200640)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : mouse Raw 264.7 whole cell lysate
    Lane 3 : rat PC12 whole cell lysate

    Predicted band size: 53 kDa

References

ab200640 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up