Overview

  • Product name

  • Description

    Rabbit polyclonal to DMRTA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DMRTA1 aa 201-504.
    Sequence:

    QASGSATPAFEVFQQDYPEEKQEQKESKCESCQNGQEELISKSHQLYLGS SSRSNGVIGKQSIGSSISEYSNKPDSILSPHPGEQSGGEESPRSLSSSDL ESGNESEWVKDLTATKASLPTVSSRPRDPLDILTKIFPNYRRSRLEGILR FCKGDVVQAIEQVLNGKEHKPDNRNLANSEELENTAFQRASSFSLAGIGF GTLGNKSAFSPLQTTSASYGGDSSLYGVNPRVGISPLRLAYSSAGRGLSG FMSPYLTPGLVPTLPFRPALDYAFSGMIRDSSYLSSKDSITCGRLYFRPN QDNP


    Database link: Q5VZB9

  • Positive control

    • IHC-P: Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238679 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    May be involved in sexual development.
  • Tissue specificity

    Expressed in liver, kidney, pancreas, prostate and weakly detected in testis and ovary.
  • Sequence similarities

    Belongs to the DMRT family.
    Contains 1 DM DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DMO antibody
    • DMRT-like family A1 antibody
    • Dmrt4 antibody
    • DMRTA_HUMAN antibody
    • Dmrta1 antibody
    • Doublesex- and mab-3-related transcription factor 4 antibody
    • Doublesex- and mab-3-related transcription factor A1 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for DMRTA1 using ab238679 at 1/100 dilution in immunohistochemical analysis.

References

ab238679 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238679.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up