Overview

  • Product name

  • Description

    Rabbit polyclonal to DMRTB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DMRTB1 aa 199-293.
    Sequence:

    NPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGG GLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALH


    Database link: Q96MA1

  • Positive control

    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Testis.
  • Sequence similarities

    Belongs to the DMRT family.
    Contains 1 DM DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DMRT B 1 antibody
    • DMRT like family B with proline rich C terminal 1 antibody
    • DMRTB_HUMAN antibody
    • Dmrtb1 antibody
    • Doublesex- and mab-3-related transcription factor B1 antibody
    • FLJ32711 antibody
    • FLJ40434 antibody
    • HGNC:13913 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for DMRTB1 using ab224158 at 1/200 dilution in immunohistochemical analysis.

References

ab224158 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up