
  • Product name
  • Description
    Mouse monoclonal to DMT1
  • Host species
  • Tested applications
    Suitable for: Flow Cyt, IHC-P, WB, IHC-Frmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment: MVLGPEQKMSDDSVSGDHGESASLGNINPYSNPSLSQSPGDSEEYFATYF NEKISIPEEEYSCF, corresponding to amino acids 1-66 of Human DMT1

  • General notes

    Abcam is committed to meeting high standards of ethical manufacturing and has decided to discontinue this product by June 2019 as it has been generated by the ascites method. We are sorry for any inconvenience this may cause. 



Our Abpromise guarantee covers the use of ab55735 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use 1µg for 106 cells.

ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

IHC-P Use a concentration of 3 µg/ml.
WB Use a concentration of 1 - 5 µg/ml.


IHC-Fr 1/1000.


  • Function
    Important in metal transport, in particular iron. Can also transport manganese, cobalt, cadmium, nickel, vanadium and lead. Involved in apical iron uptake into duodenal enterocytes. Involved in iron transport from acidified endosomes into the cytoplasm of erythroid precursor cells. May play an important role in hepatic iron accumulation and tissue iron distribution.
  • Tissue specificity
    Ubiquitously expressed. Isoform 1 is highly expressed in brain. Isoform 2 is highly expressed in spleen, thymus and pancreas. Isoform 3 and isoform 4 are abundantly expressed in duodenum and kidney.
  • Involvement in disease
    Defects in SLC11A2 are a cause of hypochromic microcytic anemia (HCMA) [MIM:206100]. The disease is characterized by an abnormal hemoglobin content in the erythrocytes which are reduced in size. It may be hereditary or acquired. Mutations in SLC11A2 are associated with progressive liver iron overload and normal to moderately elevated serum ferritin levels.
  • Sequence similarities
    Belongs to the NRAMP family.
  • Post-translational
    Ubiquitinated by WWP2.
  • Cellular localization
    Endosome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • DCT 1 antibody
    • dct-1 antibody
    • DCT1 antibody
    • Divalent cation transporter 1 antibody
    • Divalent metal transporter 1 antibody
    • DMT 1 antibody
    • DMT-1 antibody
    • DMT1 antibody
    • FLJ37416 antibody
    • Natural resistance associated macrophage protein 2 antibody
    • Natural resistance-associated macrophage protein 2 antibody
    • NRAM2_HUMAN antibody
    • NRAMP 2 antibody
    • NRAMP2 antibody
    • OK/SW-cl.20 antibody
    • Slc11a2 antibody
    • Solute carrier family 11 (proton coupled divalent metal ion transporters) member 2 antibody
    • Solute carrier family 11 member 2 antibody
    see all


  • IHC-Fr image of DMT1 staining on mouse duodenum using ab55735 (1:1000). The sections were fixed with paraformaldehyde and permeabilized using 0.1% TritonX in 0.1% PBS. The slides were blocked using 10 % donkey serum for 1 hour at 24°C. ab55735 was diluted 1:1000 using 0.1% TritonX with 0.1x PBS- 10% Donkeys and incubated with the slides at 4°C for 24 hours. The secondary antibody used was donkey polyclonal against mouse IgG conjugated to Alexa Fluor 568 (1:1000)

    See Abreview

  • DMT1 antibody (ab55735) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human endometrium cancer.
  • Western blot against tagged recombinant protein immunogen using ab55735 DMT1 antibody at 1ug/ml. Predicted band size of immunogen is 33 kDa
  • Overlay histogram showing SH-SY5Y cells stained with ab55735 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab55735, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in SH-SY5Y cells fixed with 80% methanol/permeabilized in 0.1% PBS-Tween used under the same conditions.


This product has been referenced in:
  • Li H  et al. Long-Term Dexamethasone Exposure Down-Regulates Hepatic TFR1 and Reduces Liver Iron Concentration in Rats. Nutrients 9:N/A (2017). WB ; Rat . Read more (PubMed: 28629118) »
  • Ma S  et al. Ferroptosis is induced following siramesine and lapatinib treatment of breast cancer cells. Cell Death Dis 7:e2307 (2016). Human . Read more (PubMed: 27441659) »

See all 3 Publications for this product

Customer reviews and Q&As

Abcam guarantees this product to work in the species/application used in this Abreview.
Immunohistochemistry (Frozen sections)
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 24°C
Mouse Tissue sections (Mouse duodenum)
Mouse duodenum
Yes - 0.1% TritonX in 0.1% PBS

Dr. Ruma Raha-Chowdhury

Verified customer

Submitted Jul 16 2013

Thank you for your email.

We have monoclonal antibody ab55735 but it not tested in ICC/IF. https://www.abcam.com/DMT1-antibody-ab55735.html


I will be pleased to offer you ...

Read More

Thank you for contacting us. Ab55735 will recognize all 4 isotypes of this protein in human as will ab123085. I've noticed that the isoforms differ at the C-terminal end. The immunogens for Ab55812 and ab117544 are against the N-terminal region of ...

Read More

Thank you for taking the time to contact us. I am sorry to hear you have had difficulty obtaining satisfactory results from this DMT1 antibody. I appreciate the time you have spent in the laboratory and understand your concerns. It is regrettable th...

Read More


Sign up