Anti-DNA ligase antibody (Biotin) (ab193493)

Overview

  • Product name

    Anti-DNA ligase antibody (Biotin)
    See all DNA ligase primary antibodies
  • Description

    Rabbit polyclonal to DNA ligase (Biotin)
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli DNA ligase aa 1-671.
    Sequence:

    MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHP ELITPDSPTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQD RLKNNEKVTWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVR TIRAIPLKLHGENIPARLEVRGEVFLPQAGFEKINEDARRTGGKVFANPR NAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGELPDTHLGRLLQFKKWG LPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQL GFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAG VLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTR EVVFPTHCPVCGSDVERVEGEAVARCTGGLICGAQRKESLKHFVSRRAMD VDGMGDKIIDQLVEKEYVHTPADLFKLTAGKLTGLERMGPKSAQNVVNAL EKAKETTFARFLYALGIREVGEATAAGLAAYFGTLEALEAASIEELQKVP DVGIVVASHVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAG KTVVLTGSLSQMSRDDAKARLVELGAKVAGSVSKKTDLVIAGEAAGSKLA KAQELGIEVIDEAEMLRLLGS


    Database link: P15042

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab193493 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 74 kDa.

Target

  • Relevance

    DNA ligase that catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double-stranded DNA using NAD as a coenzyme and as the energy source for the reaction. It is essential for DNA replication and repair of damaged DNA.
  • Database links

    • Alternative names

      • DNA ligase NAD(+) dependent antibody
      • ligA antibody
      • Polydeoxyribonucleotide synthase [NAD(+)] antibody

    References

    ab193493 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193493.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up