Overview

  • Product name

    Anti-DNA Ligase III/LIG3 antibody
    See all DNA Ligase III/LIG3 primary antibodies
  • Description

    Rabbit polyclonal to DNA Ligase III/LIG3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human DNA Ligase III/LIG3 aa 254-390.
    Sequence:

    CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDV YLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSET IRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKE


    Database link: P49916

  • Positive control

    • IHC: Human testis tissue. WB: A549, NIH-3T3 and rat cell line NBT-II whole cell lysate. ICC/IF: U-251 MG cells.
  • General notes

     This product was previously labelled as DNA Ligase III

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223739 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 113 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Interacts with DNA-repair protein XRCC1 and can correct defective DNA strand-break repair and sister chromatid exchange following treatment with ionizing radiation and alkylating agents.
  • Tissue specificity

    Testis, thymus, prostate and heart.
  • Sequence similarities

    Belongs to the ATP-dependent DNA ligase family.
    Contains 1 BRCT domain.
    Contains 1 PARP-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • D11Wsu78e antibody
    • DNA ligase antibody
    • DNA ligase 3 antibody
    • DNA ligase III antibody
    • DNLI3_HUMAN antibody
    • LIG 3 antibody
    • LIG2 antibody
    • LIG3 antibody
    • Ligase II, DNA, ATP dependent antibody
    • Ligase III DNA ATP dependent antibody
    • MGC78176 antibody
    • OTTMUSP00000000875 antibody
    • Polydeoxyribonucleotide synthase [ATP] 3 antibody
    • Polydeoxyribonucleotide synthase [ATP] antibody
    • Polydeoxyribonucleotide synthase antibody
    • RP23-316C11.6 antibody
    see all

Images

  • Anti-DNA Ligase III/LIG3 antibody (ab223739) at 1/100 dilution + A549 (human lung carcinoma cell line) whole cell lysate

    Predicted band size: 113 kDa

  • Paraffin-embedded human testis tissue stained for DNA Ligase III/LIG3 using ab223739 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-DNA Ligase III/LIG3 antibody (ab223739) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) whole cell lysate
    Lane 2 : NBT-II (rat cell line) whole cell lysate

    Predicted band size: 113 kDa

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for DNA Ligase III/LIG3 (green) using ab223739 at 4 µg/ml in ICC/IF.

References

ab223739 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223739.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up