Overview

  • Product name

    Anti-DNA Ligase IV/LIG4 antibody
    See all DNA Ligase IV/LIG4 primary antibodies
  • Description

    Rabbit polyclonal to DNA Ligase IV/LIG4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, IP, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to DNA Ligase IV/LIG4 (internal sequence).
    Sequence:

    IADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQF

  • General notes

     This product was previously labelled as DNA Ligase IV

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab26039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 4 - 8 µg/ml.
IP Use at an assay dependent concentration. PubMed: 18451142
WB Use a concentration of 1.25 µg/ml. Predicted molecular weight: 109 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Efficiently joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. The LIG4-XRCC4 complex is responsible for the NHEJ ligation step, and XRCC4 enhances the joining activity of LIG4. Binding of the LIG4-XRCC4 complex to DNA ends is dependent on the assembly of the DNA-dependent protein kinase complex DNA-PK to these DNA ends.
  • Tissue specificity

    Testis, thymus, prostate and heart.
  • Involvement in disease

    LIG4 syndrome
    Severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-negative/NK-cell-positive with sensitivity to ionizing radiation
  • Sequence similarities

    Belongs to the ATP-dependent DNA ligase family.
    Contains 2 BRCT domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA ligase IV ATP dependent antibody
    • DNA joinase antibody
    • DNA ligase 4 antibody
    • DNA ligase IV antibody
    • DNA repair enzyme antibody
    • DNLI4_HUMAN antibody
    • LIG 4 antibody
    • LIG4 antibody
    • LIG4S antibody
    • Ligase IV antibody
    • Ligase IV DNA ATP dependent antibody
    • Polydeoxyribonucleotide synthase [ATP] 4 antibody
    • Polydeoxyribonucleotide synthase 4 antibody
    • Polydeoxyribonucleotide synthase antibody
    • Polynucleotide ligase antibody
    • Sealase antibody
    see all

Images

  • Anti-DNA Ligase IV/LIG4 antibody (ab26039) at 1.25 µg/ml + HepG2 cell lysate

    Predicted band size: 109 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pancreas tissue labelling DNA Ligase IV/LIG4 with ab26039 at a concentration of 4-8µg/ml. Cells with positive label (as indicated by the arrows) are epithelial cells of the pancreatic acinus. Magnification 400X.

References

This product has been referenced in:

  • Zhu Y  et al. Tamoxifen-resistant breast cancer cells are resistant to DNA-damaging chemotherapy because of upregulated BARD1 and BRCA1. Nat Commun 9:1595 (2018). Read more (PubMed: 29686231) »
  • Qiu Z  et al. Generation of Gross Chromosomal Rearrangements by a Single Engineered DNA Double Strand Break. Sci Rep 7:43156 (2017). Read more (PubMed: 28225067) »
See all 12 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

1-2 of 2 Abreviews

Application
Western blot
Sample
Human Cell lysate - nuclear (Vascular Smooth Muscle Cell)
Gel Running Conditions
Reduced Denaturing
Loading amount
25 µg
Specification
Vascular Smooth Muscle Cell
Blocking step
Milk as blocking agent for 3 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Dr. Andrew Cobb

Verified customer

Submitted Mar 20 2012

Application
Western blot
Sample
Human Cell lysate - whole cell (293T)
Gel Running Conditions
Non-reduced Denaturing (8%)
Loading amount
100 µg
Treatment
NCS 200ug/ul
Specification
293T
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Mrs. Maayan Salton

Verified customer

Submitted May 28 2010

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up