Overview

  • Product name

    Anti-DNA Polymerase epsilon p59 antibody
    See all DNA Polymerase epsilon p59 primary antibodies
  • Description

    Rabbit polyclonal to DNA Polymerase epsilon p59
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human DNA Polymerase epsilon p59 aa 140-180 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    RTHRHELFTPPVIGSHPDESGSKFQLKTIETLLGSTTKIGD


    Database link: P56282

  • Positive control

    • Rat brain and mouse embyro tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203091 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse embryo tissue labeling DNA Polymerase epsilon p59 with ab203091 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat brain tissue labeling DNA Polymerase epsilon p59 with ab203091 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203091 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203091.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up