Anti-DNA polymerase eta antibody (ab186677)
Key features and details
- Rabbit polyclonal to DNA polymerase eta
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DNA polymerase eta antibody
See all DNA polymerase eta primary antibodies -
Description
Rabbit polyclonal to DNA polymerase eta -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human DNA polymerase eta aa 417-529.
Sequence:PPLTMLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGS GPAVTATKKATTSLESFFQKAAERQKVKEASLSSLTAPTQAPMSNSPSKP SLPFQTSQSTGTE
Database link: Q9Y253 -
Positive control
- U251MG cells; Human stomach tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab186677 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. | |
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Plays an important role in the repair of UV-induced pyrimidine dimers. Depending on the context, it inserts the correct base, but causes frequent base transitions and transversions. May play a role in hypermutation at immunoglobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have lyase activity. Targets POLI to replication foci. -
Involvement in disease
Defects in POLH are the cause of xeroderma pigmentosum variant type (XPV) [MIM:278750]; also designated as XP-V. Xeroderma pigmentosum (XP) is an autosomal recessive disease due to deficient nucleotide excision repair. It is characterized by hypersensitivity of the skin to sunlight, followed by high incidence of skin cancer and frequent neurologic abnormalities. XPV shows normal nucleotide excision repair, but an exaggerated delay in recovery of replicative DNA synthesis. Most XPV patients do not develop clinical symptoms and skin neoplasias until a later age. Clinical manifestations are limited to photo-induced deterioration of the skin and eyes. -
Sequence similarities
Belongs to the DNA polymerase type-Y family.
Contains 1 umuC domain. -
Domain
The catalytic core consists of fingers, palm and thumb subdomains, but the fingers and thumb subdomains are much smaller than in high-fidelity polymerases; residues from five sequence motifs of the Y-family cluster around an active site cleft that can accommodate DNA and nucleotide substrates with relaxed geometric constraints, with consequently higher rates of misincorporation and low processivity. -
Cellular localization
Nucleus. Accumulates at replication forks after DNA damage. - Information by UniProt
-
Database links
- Entrez Gene: 5429 Human
- Omim: 603968 Human
- SwissProt: Q9Y253 Human
- Unigene: 655467 Human
-
Alternative names
- DNA polymerase eta antibody
- FLJ16395 antibody
- FLJ21978 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-DNA polymerase eta antibody (ab186677)Immunofluorescent analysis of U251MG cells (PFA-fixed/Triton X-100 permeabilized) labeling DNA polymerase eta with ab186677 at 4μg/ml.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNA polymerase eta antibody (ab186677)Immunohistochemical analysis of Paraffin-embedded Human stomach tissue labeling DNA polymerase eta with ab186677 at 1/50 dilution.
Protocols
Datasheets and documents
References (2)
ab186677 has been referenced in 2 publications.
- Srivastava M et al. Replisome Dynamics and Their Functional Relevance upon DNA Damage through the PCNA Interactome. Cell Rep 25:3869-3883.e4 (2018). PubMed: 30590055
- Ong DST et al. PAF promotes stemness and radioresistance of glioma stem cells. Proc Natl Acad Sci U S A 114:E9086-E9095 (2017). PubMed: 29073105
