Overview

  • Product name

    Anti-DNA polymerase eta antibody
    See all DNA polymerase eta primary antibodies
  • Description

    Rabbit polyclonal to DNA polymerase eta
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DNA polymerase eta aa 408-609.
    Sequence:

    TSGIQTEWSPPLTMLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVT SSEAKTQGSGPAVTATKKATTSLESFFQKAAERQKVKEASLSSLTAPTQA PMSNSPSKPSLPFQTSQSTGTEPFFKQKSLLLKQKQLNNSSVSSPQQNPW SNCKALPNSLPTEYPGCVPVCEGVSKLEESSKATPAEMDLAHNSQSMHAS SA


    Database link: Q9Y253

  • Positive control

    • WB: A549 and K562 cell lysate. IHC-P: Human tonsil tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 78 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Plays an important role in the repair of UV-induced pyrimidine dimers. Depending on the context, it inserts the correct base, but causes frequent base transitions and transversions. May play a role in hypermutation at immunoglobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have lyase activity. Targets POLI to replication foci.
  • Involvement in disease

    Defects in POLH are the cause of xeroderma pigmentosum variant type (XPV) [MIM:278750]; also designated as XP-V. Xeroderma pigmentosum (XP) is an autosomal recessive disease due to deficient nucleotide excision repair. It is characterized by hypersensitivity of the skin to sunlight, followed by high incidence of skin cancer and frequent neurologic abnormalities. XPV shows normal nucleotide excision repair, but an exaggerated delay in recovery of replicative DNA synthesis. Most XPV patients do not develop clinical symptoms and skin neoplasias until a later age. Clinical manifestations are limited to photo-induced deterioration of the skin and eyes.
  • Sequence similarities

    Belongs to the DNA polymerase type-Y family.
    Contains 1 umuC domain.
  • Domain

    The catalytic core consists of fingers, palm and thumb subdomains, but the fingers and thumb subdomains are much smaller than in high-fidelity polymerases; residues from five sequence motifs of the Y-family cluster around an active site cleft that can accommodate DNA and nucleotide substrates with relaxed geometric constraints, with consequently higher rates of misincorporation and low processivity.
  • Cellular localization

    Nucleus. Accumulates at replication forks after DNA damage.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA polymerase eta antibody
    • FLJ16395 antibody
    • FLJ21978 antibody
    • Polh antibody
    • POLH_HUMAN antibody
    • polymerase DNA directed eta antibody
    • RAD30 antibody
    • RAD30 homolog A antibody
    • RAD30A antibody
    • Xeroderma pigmentosum variant type protein antibody
    • XP V antibody
    • XPV antibody
    see all

Images

  • All lanes : Anti-DNA polymerase eta antibody (ab234855) at 1/500 dilution

    Lane 1 : A549 (Human lung carcinoma cell line) cell lysate
    Lane 2 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 78 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling DNA polymerase eta using ab234855 at 1/100 dilution in ICC/IF. Secondary antibody was an Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

  • Paraffin-embedded human tonsil tissue stained for DNA polymerase eta using ab234855 at 1/100 dilution in immunohistochemical analysis.

References

ab234855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up