Overview

  • Product name

    Anti-DNA polymerase I antibody
  • Description

    Rabbit polyclonal to DNA polymerase I
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to DNA polymerase I, thermostable aa 310-832. Thermus aquaticus
    Sequence:

    VLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVL ALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALS ERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRAL SLEVAEEIARLEAEVFRLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKT GKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLPDLIHPRTGR LHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVAL DYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMR RAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSFPKVRAWIEK TLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAAD LMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEG VYPLAVPLEVEVGIGEDWLSAKE


    Database link: P19821

  • Positive control

    • 293T whole cell lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95%,Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab193613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 94 kDa (predicted molecular weight: 94 kDa).
ELISA Use at an assay dependent concentration.

Target

  • Relevance

    Catalytic activity: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1)
  • Alternative names

    • pol1 antibody
    • polA antibody
    • Taq polymerase 1 antibody

Images

  • Anti-BACE1 antibody (ab183613) at 2 µg/ml + 293T whole cell lysate

    Secondary
    Goat polyclonal to Rabbit IgG at 1/1000 dilution

    Predicted band size: 94 kDa
    Observed band size: 94 kDa

References

ab193613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up