Overview

  • Product name

    Anti-DNA Polymerase iota antibody [OTI1H9]
    See all DNA Polymerase iota primary antibodies
  • Description

    Mouse monoclonal [OTI1H9] to DNA Polymerase iota
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DNA Polymerase iota aa 458-740. (NP_009126) produced in E.coli.
    Sequence:

    STTSRSGKHSFKMKDTHMEDFPKDKETNRDFLPSGRIESTRTRESPLDTT NFSKEKDINEFPLCSLPEGVDQEVFKQLPVDIQEEILSGKSREKFQGKGS VSCPLHASRGVLSFFSKKQMQDIPINPRDHLSSSKQVSSVSPCEPGTSGF NSSSSSYMSSQKDYSYYLDNRLKDERISQGPKEPQGFHFTNSNPAVSAFH SFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDEKITFPSD IDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK


    Database link: Q9UNA4

  • Positive control

    • WB: HEK-293T cells transfected with pCMV6-ENTRY DNA Polymerase iota cDNA.
  • General notes

    The clone number has been updated from 1H9 to OTI1H9, both clone numbers name the same clone.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OTI1H9
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab157244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 83 kDa.

Target

  • Function

    Error-prone DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Favors Hoogsteen base-pairing in the active site. Inserts the correct base with high-fidelity opposite an adenosine template. Exhibits low fidelity and efficiency opposite a thymidine template, where it will preferentially insert guanosine. May play a role in hypermutation of immunogobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but may not have lyase activity.
  • Tissue specificity

    Ubiquitous. Highly expressed in testis.
  • Sequence similarities

    Belongs to the DNA polymerase type-Y family.
    Contains 1 umuC domain.
  • Domain

    The catalytic core consists of fingers, palm and thumb subdomains, but the fingers and thumb subdomains are much smaller than in high-fidelity polymerases; residues from five sequence motifs of the Y-family cluster around an active site cleft that can accommodate DNA and nucleotide substrates with relaxed geometric constraints, with consequently higher rates of misincorporation and low processivity.
  • Cellular localization

    Nucleus. Accumulates at replication forks after DNA damage.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA polymerase iota antibody
    • Eta 2 antibody
    • Eta2 antibody
    • POLI antibody
    • POLI_HUMAN antibody
    • Polymerase (DNA directed) iota antibody
    • RAD 30B antibody
    • RAD30 homolog B antibody
    • RAD30, S. cerevisiae, homolog of antibody
    • RAD30B antibody
    • RAD3OB antibody
    see all

Images

  • All lanes : Anti-DNA Polymerase iota antibody [OTI1H9] (ab157244) at 1/2000 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY DNA Polymerase iota cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 83 kDa

References

ab157244 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up