Overview

  • Product name

    Anti-DNA polymerase mu antibody
    See all DNA polymerase mu primary antibodies
  • Description

    Rabbit polyclonal to DNA polymerase mu
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DNA polymerase mu aa 64-155.
    Sequence:

    SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQ PVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG


    Database link: Q9NP87

  • Positive control

    • ICC/IF: U-251 MG cells. WB: RT4 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221653 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/250 - 1/500. Predicted molecular weight: 55 kDa.

Target

  • Function

    Gap-filling polymerase involved in repair of DNA double-strand breaks by non-homologous end joining (NHEJ). Participates in immunoglobulin (Ig) light chain gene rearrangement in V(D)J recombination.
  • Tissue specificity

    Expressed in a number of tissues. Abundant in thymus.
  • Sequence similarities

    Belongs to the DNA polymerase type-X family.
    Contains 1 BRCT domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA-directed DNA polymerase mu antibody
    • DNA-directed DNA/RNA polymerase mu antibody
    • DPOLM_HUMAN antibody
    • FLJ35482 antibody
    • Pol iota antibody
    • Pol Mu antibody
    • Polm antibody
    • POLM protein antibody
    • Polymerase (DNA directed) mu antibody
    • Polymerase DNA directed mu antibody
    • Tdt N antibody
    • Tdt-N antibody
    • TdtN antibody
    • Terminal transferase antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for DNA polymerase mu (green) using ab221653 at 4 µg/ml in ICC/IF.

  • Anti-DNA polymerase mu antibody (ab221653) at 1/250 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 55 kDa

References

ab221653 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221653.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up