Overview

  • Product name

  • Description

    Rabbit polyclonal to DNA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human DNA2 aa 213-313.
    Sequence:

    YLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIE ESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRS Q


    Database link: P51530

  • Positive control

    • U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May function in chromosomal DNA replication.
  • Sequence similarities

    Belongs to the DNA2/NAM7 helicase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA replication ATP-dependent helicase-like homolog antibody
    • DNA replication helicase 2 homolog antibody
    • DNA replication helicase 2, yeast, homolog of antibody
    • DNA replication helicase 2-like antibody
    • DNA replication helicase/nuclease 2 antibody
    • DNA2 antibody
    • DNA2-like helicase antibody
    • DNA2L antibody
    • DNA2L_HUMAN antibody
    • HDNA2 antibody
    • KIAA0083 antibody
    • PEOA6 antibody
    • SCKL8 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized U-2 OS cells labeling DNA2 with ab220883 at 4 µg/mL (green).

References

ab220883 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up