Anti-DNAJA1 antibody (ab192904)
Key features and details
- Rabbit polyclonal to DNAJA1
- Suitable for: WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-DNAJA1 antibody
See all DNAJA1 primary antibodies -
Description
Rabbit polyclonal to DNAJA1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Orangutan -
Immunogen
Synthetic peptide within Human DNAJA1 aa 250-300. The exact sequence is proprietary. (NP_001530.1).
Sequence:VFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGD I
Database link: P31689 -
Positive control
- HeLa, 293T, Jurkat, TCMK-1 and NIH3T3 whole cell lysates.
-
General notes
This product was previously labelled as HDJ2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab192904 was affinity purified using an epitope specific to DNAJA1 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab192904 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000 - 1/1000. Predicted molecular weight: 45 kDa. |
Target
-
Function
Co-chaperone of Hsc70. Seems to play a role in protein import into mitochondria. -
Sequence similarities
Contains 1 CR-type zinc finger.
Contains 1 J domain. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 746627 Chimpanzee
- Entrez Gene: 528862 Cow
- Entrez Gene: 100855671 Dog
- Entrez Gene: 100053747 Horse
- Entrez Gene: 3301 Human
- Entrez Gene: 15502 Mouse
- Entrez Gene: 100512008 Pig
- Entrez Gene: 100346508 Rabbit
see all -
Alternative names
- DJ 2 antibody
- DJ2 antibody
- DjA1 antibody
see all
Images
-
All lanes : Anti-DNAJA1 antibody (ab192904) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate
Lane 2 : 293T whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lane 4 : TCMK-1 whole cell lysate
Lane 5 : NIH3T3 whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 45 kDa
Exposure time: 3 minutesLysates prepared using NETN lysis buffer.
Datasheets and documents
References (0)
ab192904 has not yet been referenced specifically in any publications.