Overview

  • Product name

  • Description

    Rabbit polyclonal to DNAJA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, African green monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human DNAJA1 aa 8-106.
    Sequence:

    YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSD AKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKN


    Database link: P31689

  • Positive control

    • WB: HeLa whole cell lysate. IHC-P: Human placenta tissue. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as HDJ2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 45 kDa (predicted molecular weight: 45 kDa).
IHC-P 1/1000 - 1/2000.
ICC/IF 1/50 - 1/500.

Target

Images

  • Anti-DNAJA1 antibody (ab234702) at 1/500 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 45 kDa
    Observed band size: 45 kDa

  • Paraffin-embedded human placenta tissue stained for DNAJA1 using ab234702 at 1/1000 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for DNAJA1 (green) using ab234702 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG(H+L).

References

ab234702 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up