Overview

  • Product name

  • Description

    Rabbit polyclonal to DNAJA4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human DNAJA4 aa 318-397.
    Sequence:

    KGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKEF CPNEQNWRQHREAYEEDEDGPQAGVQCQTA


    Database link: Q8WW22

  • Positive control

    • RT-4 and U-251 MG cell lysates; U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220273 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 45 kDa.

Target

Images

  • All lanes : Anti-DNAJA4 antibody (ab220273) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Developed using the ECL technique.

    Predicted band size: 45 kDa

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling DNAJA4 with ab220273 at 4 µg/mL (green).  

References

ab220273 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220273.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up