Overview

  • Product name

    Anti-DNAJB13 antibody
  • Description

    Rabbit polyclonal to DNAJB13
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DNAJB13 aa 183-276.
    Sequence:

    DVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFF VNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGE


    Database link: P59910

  • Positive control

    • Human bronchus tissue

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185301 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May be involved in inhibiting testis spermatogenesis apoptosis.
  • Tissue specificity

    Specifically expressed in testis.
  • Sequence similarities

    Contains 1 J domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1700014P03Rik antibody
    • DJB13_HUMAN antibody
    • DnaJ (Hsp40) homolog subfamily B member 13 antibody
    • DnaJ (Hsp40) related subfamily B member 13 antibody
    • DnaJ homolog subfamily B member 13 antibody
    • DnaJ like protein antibody
    • DNAJB13 antibody
    • FLJ46748 antibody
    • Radial spoke 16 homolog A antibody
    • RSPH16A antibody
    • testis and spermatogenesis cell related protein 6 antibody
    • Testis and spermatogenesis cell-related protein 6 antibody
    • testis spermatocyte apoptosis related gene 6 protein antibody
    • Testis spermatocyte apoptosis-related gene 6 protein antibody
    • testis spermatogenesis apoptosis related gene 3 protein antibody
    • testis spermatogenesis apoptosis related gene 6 protein antibody
    • Testis spermatogenesis apoptosis related protein 6 antibody
    • Testis spermatogenesis apoptosis-related gene 3 protein antibody
    • Testis spermatogenesis apoptosis-related gene 6 protein antibody
    • TSARG5 antibody
    • TSARG6 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human bronchus tissue, labeling DNAJB13 with ab185301 at 1/50 dilution.

References

ab185301 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185301.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up