Overview

  • Product name

  • Description

    Rabbit polyclonal to DNAJB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DNAJB2 aa 215-324.
    Sequence:

    GLELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLS EMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSP EEKASRCLIL


    Database link: P25686

  • Positive control

    • WB: HEK-293T, PC-3 and A431 whole cell lysates. IHC-P: Human brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 36 kDa (predicted molecular weight: 36, 31 kDa).
IHC-P 1/20 - 1/200.

Target

  • Relevance

    DNAJB2 is involved in heat shock protein and unfolded protein binding.
  • Database links

  • Alternative names

    • Descriptions antibody
    • DnaJ (Hsp40) homolog subfamily B member 2 antibody
    • DnaJ homolog subfamily B member 2 antibody
    • DnaJ protein homolog 1 antibody
    • DNAJB2 antibody
    • Heat shock 40 kDa protein 3 antibody
    • Heat shock protein J1 antibody
    • Heat shock protein neuronal DNAJ like 1 antibody
    • HSJ 1 antibody
    • HSJ1 antibody
    • HSPF3 antibody
    see all

Images

  • All lanes : Anti-DNAJB2 antibody (ab230249) at 1/1000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 36, 31 kDa
    Observed band size: 36 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human brain tissue stained for DNAJB2 with ab230249 at 1/100 dilution in immunohistochemical analysis.

References

ab230249 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up