Overview

  • Product name

  • Description

    Rabbit polyclonal to DNAJB4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human DNAJB4 aa 1-337.
    Sequence:

    MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAE AYEVLSDPKKREIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAA FFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVG PSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKIL TIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNI IYTAKISLREALCGCSINVPTLDGRNIPMSVNDIVKPGMRRRIIGYGLPF PKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS


    Database link: Q9UDY4

  • Positive control

    • WB: HeLa whole cell lysate; Mouse heart tissue lysate. IHC-P: Human adrenal gland and pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Probable chaperone.
  • Tissue specificity

    Expressed in heart, pancreas and skeletal muscle, and to a lesser extent in brain, placenta and liver.
  • Sequence similarities

    Contains 1 J domain.
  • Cellular localization

    Cytoplasm. Cell membrane. Cytoplasmic according to PubMed:18837411 and membrane-associated according to PubMed:16542645.
  • Information by UniProt
  • Database links

  • Alternative names

    • DjB4 antibody
    • DnaJ (Hsp40) homolog subfamily B member 4 antibody
    • DnaJ homolog subfamily B member 4 antibody
    • DnaJ like heat shock protein 40 antibody
    • DNAJB 4 antibody
    • DNAJB4 antibody
    • DNAJW antibody
    • DNJB4_HUMAN antibody
    • Heat shock 40 kDa protein 1 homolog antibody
    • Heat shock protein 40 homolog antibody
    • HLJ 1 antibody
    • HLJ1 antibody
    • HSP40 homolog antibody
    • Human liver DnaJ-like protein antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for DNAJB4 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-DNAJB4 antibody (ab235406) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Mouse heart tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human pancreas tissue stained for DNAJB4 at 1/100 dilution in immunohistochemical analysis.

References

ab235406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up