Anti-MCJ antibody (ab167199)
Key features and details
- Mouse polyclonal to MCJ
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MCJ antibody -
Description
Mouse polyclonal to MCJ -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human MCJ aa 1-150.
Sequence:MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAAL AFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLI LGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
-
Positive control
- Lysate of 293T cells transfected with MCJ.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab167199 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 16 kDa.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 16 kDa. |
Target
-
Function
Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP (By similarity). Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9. -
Tissue specificity
Expressed at highest levels in heart, followed by liver and kidney. -
Involvement in disease
Absent or down-regulated in many advanced cases of ovarian adenocarcinoma, due to hypermethylation and allelic loss. Loss of expression correlates with increased resistance to antineoplastic drugs, such as cisplatin. -
Sequence similarities
Contains 1 J domain. -
Cellular localization
Mitochondrion inner membrane. - Information by UniProt
-
Database links
- Entrez Gene: 29103 Human
- Omim: 615339 Human
- SwissProt: Q9Y5T4 Human
- Unigene: 438830 Human
-
Alternative names
- Cell growth inhibiting gene 22 protein antibody
- Cell growth-inhibiting gene 22 protein antibody
- DJC15_HUMAN antibody
see all
Images
Datasheets and documents
-
Datasheet download
References (0)
ab167199 has not yet been referenced specifically in any publications.