Overview

  • Product name

  • Description

    Rabbit polyclonal to DNAJC19
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human DNAJC19 aa 1-116.
    Sequence:

    MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYY RGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIA AKINEAKDLLEGQAKK


    Database link: Q96DA6

  • Positive control

    • WB: A549, HL-60 and HeLa whole cell lysates; Mouse kidney tissue lysate. IHC-P: Human brain and kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 12 kDa.

Target

  • Function

    Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity.
  • Tissue specificity

    Ubiquitously expressed.
  • Involvement in disease

    Defects in DNAJC19 are the cause of 3-methylglutaconic aciduria type 5 (MGA5) [MIM:610198]; also known as dilated cardiomyopathy with ataxia (DCMA). MGA5 is an autosomal recessive disorder characterized by early-onset dilated cardiomyopathy, growth failure, cerebellar ataxia causing significant motor delays, testicular dysgenesis, growth failure, and significant increases in urine organic acids, particularly 3-methylglutaconic acid and 3-methylglutaric acid.
  • Sequence similarities

    Belongs to the TIM14 family.
    Contains 1 J domain.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DnaJ (Hsp40) homolog, subfamily C, member 19 antibody
    • DnaJ homolog subfamily C member 19 antibody
    • DNAJC19 antibody
    • homolog of yeast TIM14 antibody
    • Mitochondrial import inner membrane translocase subunit TIM14 antibody
    • PAM18 antibody
    • TIM 14 antibody
    • TIM14 antibody
    • TIM14_HUMAN antibody
    • TIMM 14 antibody
    • TIMM14 antibody
    • translocase of the inner mitochondrial membrane 14 antibody
    • Translocase of the inner mitochondrial membrane 14, yeast homolog of antibody
    see all

Images

  • All lanes : Anti-DNAJC19 antibody (ab230244) at 1/1000 dilution

    Lane 1 : Mouse kidney tissue lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : HL-60 (human promyelocytic leukemia cell line) whole cell lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 12 kDa
    Observed band size: 12 kDa

  • Paraffin-embedded human brain tissue stained for DNAJC19 using ab230244 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for DNAJC19 using ab230244 at 1/100 dilution in immunohistochemical analysis.

References

ab230244 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up