Overview

  • Product name

  • Description

    Rabbit polyclonal to DNAJC21
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human DNAJC21 aa 330-418.
    Sequence:

    KNHEKSKKHREMVALLKQQLEEEEENFSRPQIDENPLDDNSEEEMEDAPK QKLSKKQKKKKQKPAQNYDDNFNVNGPGEGVKVDPEDTN


    Database link: Q5F1R6

  • Positive control

    • ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May act as a co-chaperone for HSP70.
  • Tissue specificity

    Brain, placenta, kidney and pancreas.
  • Sequence similarities

    Contains 2 C2H2-type zinc fingers.
    Contains 1 J domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • DJC21_HUMAN antibody
    • DnaJ homolog subfamily A member 5 antibody
    • DnaJ homolog subfamily C member 21 antibody
    • DNAJA5 antibody
    • dnajc21 antibody
    • GS3 antibody
    • JJJ1 antibody
    • Protein GS3 antibody
    see all

Images

  • Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized U-2 OS cells labeling DNAJC21 with ab220603 at 4 µg/mL (green).

References

ab220603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up