Anti-DNAJC2/ZRF1 antibody (ab231318)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-DNAJC2/ZRF1 antibody
See all DNAJC2/ZRF1 primary antibodies -
Description
Rabbit polyclonal to DNAJC2/ZRF1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Cow
-
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Mouse DNAJC2/ZRF1 aa 368-621. (Expressed in E.coli).
Sequence:DNEADRVKMMEEVEKLCDRLELASLQGLNEILASSTREVGKAALEKQIEE VNEQMRREKEEADARMRQASKNAEKSTGGSGSGSKNWSEDDLQLLIKAVN LFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVISKAKSLQKLDPHQKDDI NKKAFDKFKKEHGVASQADSAAPSERFEGPCIDSTPWTTEEQKLLEQALK TYPVNTPERWEKIAEAVPGRTKKDCMRRYKELVEMVKAKKAAQEQVLNAS RARK
Database link: P54103 -
Positive control
- IHC-P: Mouse liver, testis, kidney and stomach tissues. WB: HeLa and HEK-293T cell lysates; Mouse testis lysate; Recombinant mouse DNAJC2/ZRF1 protein.
-
General notes
This product was previously labelled as DNAJC2
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab231318 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab231318 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 72 kDa. | |
| IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Acts both as a chaperone in the cytosol and as a chromatin regulator in the nucleus. When cytosolic, acts as a molecular chaperone: component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, stimulates the ATPase activity of the ribosome-associated pool of Hsp70-type chaperones HSPA14 that bind to the nascent polypeptide chain. When nuclear, mediates the switching from polycomb-repressed genes to an active state: specifically recruited at histone H2A ubiquitinated at 'Lys-119' (H2AK119ub), and promotes the displacement of the polycomb PRC1 complex from chromatin, thereby facilitating transcription activation. Specifically binds DNA sequence 5'-GTCAAGC-3'. -
Tissue specificity
Widely expressed. -
Sequence similarities
Contains 1 J domain.
Contains 2 SANT domains. -
Domain
The ZRF1-UBD region specifically recognizes and binds H2AK119ub. The ZRF1-UBD region is also involved in protein-protein interactions with other proteins, suggesting that it may be masked by some regulator, thereby preventing its association with H2AK119ub. -
Post-translational
modificationsPhosphorylated in M (mitotic) phase. -
Cellular localization
Nucleus. Cytoplasm > cytosol. - Information by UniProt
-
Database links
- Entrez Gene: 507897 Cow
- Entrez Gene: 27000 Human
- Entrez Gene: 22791 Mouse
- Entrez Gene: 116456 Rat
- Omim: 605502 Human
- SwissProt: Q1RMH9 Cow
- SwissProt: Q99543 Human
- SwissProt: P54103 Mouse
see all -
Alternative names
- AU020218 antibody
- DnaJ (Hsp40) homolog subfamily C member 2 antibody
- DnaJ homolog subfamily C member 2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)Paraffin-embedded mouse liver tissue stained for DNAJC2/ZRF1 using ab231318 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)Paraffin-embedded mouse testis tissue stained for DNAJC2/ZRF1 using ab231318 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)Paraffin-embedded mouse kidney tissue stained for DNAJC2/ZRF1 using ab231318 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)Paraffin-embedded mouse stomach tissue stained for DNAJC2/ZRF1 using ab231318 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-DNAJC2/ZRF1 antibody (ab231318)Anti-DNAJC2/ZRF1 antibody (ab231318) at 1 µg/ml + Recombinant mouse DNAJC2 protein
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 72 kDa -
Western blot - Anti-DNAJC2/ZRF1 antibody (ab231318)All lanes : Anti-DNAJC2/ZRF1 antibody (ab231318) at 1 µg/ml
Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 3 : Mouse testis lysate
Secondary
All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 72 kDa
Datasheets and documents
References
ab231318 has not yet been referenced specifically in any publications.
