For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    dnajc2zrf1-antibody-ab231318.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Trafficking Chaperones Other Chaperones
Share by email

Anti-DNAJC2/ZRF1 antibody (ab231318)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)
  • Western blot - Anti-DNAJC2/ZRF1 antibody (ab231318)
  • Western blot - Anti-DNAJC2/ZRF1 antibody (ab231318)

Key features and details

  • Rabbit polyclonal to DNAJC2/ZRF1
  • Suitable for: WB, IHC-P
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-DNAJC2/ZRF1 antibody
    See all DNAJC2/ZRF1 primary antibodies
  • Description

    Rabbit polyclonal to DNAJC2/ZRF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse DNAJC2/ZRF1 aa 368-621. (Expressed in E.coli).
    Sequence:

    DNEADRVKMMEEVEKLCDRLELASLQGLNEILASSTREVGKAALEKQIEE VNEQMRREKEEADARMRQASKNAEKSTGGSGSGSKNWSEDDLQLLIKAVN LFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVISKAKSLQKLDPHQKDDI NKKAFDKFKKEHGVASQADSAAPSERFEGPCIDSTPWTTEEQKLLEQALK TYPVNTPERWEKIAEAVPGRTKKDCMRRYKELVEMVKAKKAAQEQVLNAS RARK


    Database link: P54103
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Mouse liver, testis, kidney and stomach tissues. WB: HeLa and HEK-293T cell lysates; Mouse testis lysate; Recombinant mouse DNAJC2/ZRF1 protein.
  • General notes

     This product was previously labelled as DNAJC2

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231318 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Protein Trafficking
    • Chaperones
    • Other Chaperones
    • Cancer
    • Tumor immunology
    • Tumor-associated antigens

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • HeLa whole cell lysate (ab150035)
    • Mouse testis normal tissue lysate - total protein (ab29289)
    • HeLa whole cell lysate (ab29545)

Applications

Our Abpromise guarantee covers the use of ab231318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 72 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Acts both as a chaperone in the cytosol and as a chromatin regulator in the nucleus. When cytosolic, acts as a molecular chaperone: component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, stimulates the ATPase activity of the ribosome-associated pool of Hsp70-type chaperones HSPA14 that bind to the nascent polypeptide chain. When nuclear, mediates the switching from polycomb-repressed genes to an active state: specifically recruited at histone H2A ubiquitinated at 'Lys-119' (H2AK119ub), and promotes the displacement of the polycomb PRC1 complex from chromatin, thereby facilitating transcription activation. Specifically binds DNA sequence 5'-GTCAAGC-3'.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Contains 1 J domain.
    Contains 2 SANT domains.
  • Domain

    The ZRF1-UBD region specifically recognizes and binds H2AK119ub. The ZRF1-UBD region is also involved in protein-protein interactions with other proteins, suggesting that it may be masked by some regulator, thereby preventing its association with H2AK119ub.
  • Post-translational
    modifications

    Phosphorylated in M (mitotic) phase.
  • Cellular localization

    Nucleus. Cytoplasm > cytosol.
  • Target information above from: UniProt accession Q99543 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 507897 Cow
    • Entrez Gene: 27000 Human
    • Entrez Gene: 22791 Mouse
    • Entrez Gene: 116456 Rat
    • Omim: 605502 Human
    • SwissProt: Q1RMH9 Cow
    • SwissProt: Q99543 Human
    • SwissProt: P54103 Mouse
    • SwissProt: Q7TQ20 Rat
    • Unigene: 558476 Human
    • Unigene: 266312 Mouse
    • Unigene: 11908 Rat
    see all
  • Alternative names

    • AU020218 antibody
    • DnaJ (Hsp40) homolog subfamily C member 2 antibody
    • DnaJ homolog subfamily C member 2 antibody
    • Dnajc2 antibody
    • DNJC2_HUMAN antibody
    • M phase phosphoprotein 11 antibody
    • M-phase phosphoprotein 11 antibody
    • MGC105894 antibody
    • MIDA1 antibody
    • MPHOSPH11 antibody
    • MPP11 antibody
    • OTTMUSP00000031226 antibody
    • ZRF1 antibody
    • Zrf2 antibody
    • ZUO1 antibody
    • Zuotin related factor 1 antibody
    • Zuotin related factor 2 antibody
    • Zuotin-related factor 1 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)

    Paraffin-embedded mouse liver tissue stained for DNAJC2/ZRF1 using ab231318 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)

    Paraffin-embedded mouse testis tissue stained for DNAJC2/ZRF1 using ab231318 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)

    Paraffin-embedded mouse kidney tissue stained for DNAJC2/ZRF1 using ab231318 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)

    Paraffin-embedded mouse stomach tissue stained for DNAJC2/ZRF1 using ab231318 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Western blot - Anti-DNAJC2/ZRF1 antibody (ab231318)
    Western blot - Anti-DNAJC2/ZRF1 antibody (ab231318)
    Anti-DNAJC2/ZRF1 antibody (ab231318) at 1 µg/ml + Recombinant mouse DNAJC2 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 72 kDa

  • Western blot - Anti-DNAJC2/ZRF1 antibody (ab231318)
    Western blot - Anti-DNAJC2/ZRF1 antibody (ab231318)
    All lanes : Anti-DNAJC2/ZRF1 antibody (ab231318) at 1 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 3 : Mouse testis lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 72 kDa

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab231318? Please let us know so that we can cite the reference in this datasheet.

    ab231318 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab231318.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.