Anti-DNAJC2/ZRF1 antibody (ab231318)
Key features and details
- Rabbit polyclonal to DNAJC2/ZRF1
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-DNAJC2/ZRF1 antibody
See all DNAJC2/ZRF1 primary antibodies -
Description
Rabbit polyclonal to DNAJC2/ZRF1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Cow -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Mouse DNAJC2/ZRF1 aa 368-621. (Expressed in E.coli).
Sequence:DNEADRVKMMEEVEKLCDRLELASLQGLNEILASSTREVGKAALEKQIEE VNEQMRREKEEADARMRQASKNAEKSTGGSGSGSKNWSEDDLQLLIKAVN LFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVISKAKSLQKLDPHQKDDI NKKAFDKFKKEHGVASQADSAAPSERFEGPCIDSTPWTTEEQKLLEQALK TYPVNTPERWEKIAEAVPGRTKKDCMRRYKELVEMVKAKKAAQEQVLNAS RARK
Database link: P54103 -
Positive control
- IHC-P: Mouse liver, testis, kidney and stomach tissues. WB: HeLa and HEK-293T cell lysates; Mouse testis lysate; Recombinant mouse DNAJC2/ZRF1 protein.
-
General notes
This product was previously labelled as DNAJC2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab231318 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab231318 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 72 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Acts both as a chaperone in the cytosol and as a chromatin regulator in the nucleus. When cytosolic, acts as a molecular chaperone: component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, stimulates the ATPase activity of the ribosome-associated pool of Hsp70-type chaperones HSPA14 that bind to the nascent polypeptide chain. When nuclear, mediates the switching from polycomb-repressed genes to an active state: specifically recruited at histone H2A ubiquitinated at 'Lys-119' (H2AK119ub), and promotes the displacement of the polycomb PRC1 complex from chromatin, thereby facilitating transcription activation. Specifically binds DNA sequence 5'-GTCAAGC-3'. -
Tissue specificity
Widely expressed. -
Sequence similarities
Contains 1 J domain.
Contains 2 SANT domains. -
Domain
The ZRF1-UBD region specifically recognizes and binds H2AK119ub. The ZRF1-UBD region is also involved in protein-protein interactions with other proteins, suggesting that it may be masked by some regulator, thereby preventing its association with H2AK119ub. -
Post-translational
modificationsPhosphorylated in M (mitotic) phase. -
Cellular localization
Nucleus. Cytoplasm > cytosol. - Information by UniProt
-
Database links
- Entrez Gene: 507897 Cow
- Entrez Gene: 27000 Human
- Entrez Gene: 22791 Mouse
- Entrez Gene: 116456 Rat
- Omim: 605502 Human
- SwissProt: Q1RMH9 Cow
- SwissProt: Q99543 Human
- SwissProt: P54103 Mouse
see all -
Alternative names
- AU020218 antibody
- DnaJ (Hsp40) homolog subfamily C member 2 antibody
- DnaJ homolog subfamily C member 2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)
Paraffin-embedded mouse liver tissue stained for DNAJC2/ZRF1 using ab231318 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)
Paraffin-embedded mouse testis tissue stained for DNAJC2/ZRF1 using ab231318 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)
Paraffin-embedded mouse kidney tissue stained for DNAJC2/ZRF1 using ab231318 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC2/ZRF1 antibody (ab231318)
Paraffin-embedded mouse stomach tissue stained for DNAJC2/ZRF1 using ab231318 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-DNAJC2/ZRF1 antibody (ab231318) at 1 µg/ml + Recombinant mouse DNAJC2 protein
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 72 kDa -
All lanes : Anti-DNAJC2/ZRF1 antibody (ab231318) at 1 µg/ml
Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 3 : Mouse testis lysate
Secondary
All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 72 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231318 has not yet been referenced specifically in any publications.