Overview

  • Product name

    Anti-DNAJC30 antibody
  • Description

    Rabbit polyclonal to DNAJC30
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human DNAJC30 aa 1-226.
    Sequence:

    MAAMRWRWWQRLLPWRLLQARGFPQNSAPSLGLGARTYSQGDCSYSRTAL YDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVV LGSATLRRKYDRGLLSDEDLRGPGVRPSRTPAPDPGSPRTPPPTSRTHDG SRASPGANRTMFNFDAFYQAHYGEQLERERRLRARREALRKRQEYRSMKG LRWEDTRDTAAIFLIFSIFIIIGFYI


    Database link: Q96LL9

  • Positive control

    • WB: HEK-293T, U-87 MG and SH-SY5Y whole cell lysates. IHC-P: Human brain and kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235417 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 26 kDa.

Target

  • Relevance

    DNAJC30 is a member of the DNAJ molecular chaperone homology domain-containing protein family. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23.
  • Database links

  • Alternative names

    • DnaJ (Hsp40) homolog subfamily C member 30 antibody
    • DnaJ homolog subfamily C member 30 antibody
    • DNAJC 30 antibody
    • MGC12943 antibody
    • WBSCR 18 antibody
    • WBSCR18 antibody
    • Williams Beuren syndrome chromosomal region 18 protein antibody
    • Williams Beuren syndrome chromosome region 18 antibody
    see all

Images

  • All lanes : Anti-DNAJC30 antibody (ab235417) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate
    Lane 3 : SH-SY5Y (human neuroblastoma cell line from bone marrow) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 26 kDa

  • Paraffin-embedded human brain tissue stained for DNAJC30 using ab235417 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for DNAJC30 using ab235417 at 1/100 dilution in immunohistochemical analysis.

References

ab235417 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235417.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up