Overview

  • Product name

  • Description

    Rabbit polyclonal to DNAJC4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human DNAJC4 aa 1-150. Expressed in E.coli. N-terminal tags.
    Sequence:

    MPPLLPLRLCRLWPRNPPSRLLGAAAGQRSRPSTYYELLGVHPGASTEEV KRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLR SGSPPKSPRTTVHDKSAHQTHSSWTPPNAQYWSQFHSVRPQGPQLRQQQH


    Database link: Q9NNZ3

  • Positive control

    • IHC-P: Human brain tissue. WB: Pig skeletal muscle lysate; Recombinant human DNAJC4 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232804 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 28 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human brain tissue stained for DNAJC4 using ab232804 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-DNAJC4 antibody (ab232804) at 2 µg/ml + Pig skeletal muscle lysate

    Secondary
    HRP-linked Guinea pig anti-Rabbit at 1/1000 dilution

    Predicted band size: 28 kDa

  • Anti-DNAJC4 antibody (ab232804) at 2 µg/ml + Recombinant human DNAJC4 protein

    Predicted band size: 28 kDa

References

ab232804 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232804.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up