Overview

  • Product name

  • Description

    Rabbit polyclonal to DNAJC4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DNAJC4 aa 1-155.
    Sequence:

    MPPLLPLRLCRLWPRNPPSRLLGAAAGQRSRPSTYYELLGVHPGASTEEV KRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLR SGSPPKSPRTTVHDKSAHQTHSSWTPPNAQYWSQFHSVRPQGPQLRQQQH KQNKQ


    Database link: Q9NNZ3

  • Positive control

    • IHC-P: Human colon cancer tissue. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237538 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human colon cancer tissue stained for DNAJC4 using ab237538 at 1/100 dilution in immunohistochemical analysis.

  • A549 (Human lung carcinoma cell line) cells stained for DNAJC4 (green) using ab237538 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L).

References

ab237538 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237538.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up