Anti-DNAJC6 antibody (ab204434)
Key features and details
- Rabbit polyclonal to DNAJC6
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DNAJC6 antibody
See all DNAJC6 primary antibodies -
Description
Rabbit polyclonal to DNAJC6 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow -
Immunogen
Recombinant fragment corresponding to Human DNAJC6 aa 682-777.
Sequence:LGTLGSSSFASKPTTPTGLGGGFPPLSSPQKASPQPMGGGWQQGGAYNWQ QPQPKPQPSMPHSSPQNRPNYNVSFSAMPGGQNERGKGSSNLEGKQ
Database link: O75061 -
Positive control
- Human cerebral cortex tissue; U251 MG cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab204434 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 1 - 4 µg/ml. | |
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
DNAJC6 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain. -
Database links
- Entrez Gene: 9829 Human
- Entrez Gene: 72685 Mouse
- Entrez Gene: 313409 Rat
- Omim: 608375 Human
- SwissProt: Q27974 Cow
- SwissProt: O75061 Human
- SwissProt: Q80TZ3 Mouse
-
Alternative names
- auxilin antibody
- DJC6 antibody
- DnaJ (Hsp40) homolog, subfamily B, member 6 antibody
see all
Images
-
Immunofluorescent analysis of U251 MG cells (PFA-fixed/Triton X-100 permeabilized) labeling DNAJC6 with ab204434 at 4 μg/mL (green).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DNAJC6 antibody (ab204434)
Immunohistochemical analysis of paraffin-embedded human cerebral cortex tissue labeling DNAJC6 with ab204434 at 1/500 dilution.
Protocols
Datasheets and documents
References (0)
ab204434 has not yet been referenced specifically in any publications.