Anti-DNA/RNA-binding protein Alba antibody (ab234637)

Overview

  • Product name

    Anti-DNA/RNA-binding protein Alba antibody
  • Description

    Rabbit polyclonal to DNA/RNA-binding protein Alba
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Species independent
  • Immunogen

    Recombinant full length protein corresponding to Pyrococcus furiosus DNA/RNA-binding protein Alba aa 1-93.
    Sequence:

    MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEI VRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV


    Database link: Q8TZV1

  • Positive control

    • WB: Recombinant Pyrococcus furiosus DNA/RNA-binding protein Alba protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab234637 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 10 kDa.

Target

  • Alternative names

    • albA antibody

Images

  • All lanes : Anti-DNA/RNA-binding protein Alba antibody (ab234637) at 1/500 dilution

    Lane 1 : Recombinant Pyrococcus furiosus DNA/RNA-binding protein Alba protein at 0.1 µg
    Lane 2 : Recombinant Pyrococcus furiosus DNA/RNA-binding protein Alba protein at 0.05 µg
    Lane 3 : Recombinant Pyrococcus furiosus DNA/RNA-binding protein Alba protein at 0.025 µg
    Lane 4 : Recombinant Pyrococcus furiosus DNA/RNA-binding protein Alba protein at 0.0125 µg

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 10 kDa

References

ab234637 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234637.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up