Overview

  • Product name

  • Description

    Rabbit polyclonal to DNase I
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human DNase I aa 78-231.
    Sequence:

    NQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYDDGCEPCG NDTFNREPAIVRFFSRFTEVREFAIVPLHAAPGDAVAEIDALYDVYLDVQ EKWGLEDVMLMGDFNAGCSYVRPSQWSSIRLWTSPTFQWLIPDSADTTAT PTHC


    Database link: P24855

  • Positive control

    • WB: Mouse brain tissue lysate. IHC-P: Human ovarian cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224617 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 32 kDa (predicted molecular weight: 31 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Among other functions, seems to be involved in cell death by apoptosis. Binds specifically to G-actin and blocks actin polymerization.
  • Tissue specificity

    Principally in tissues of the digestive system. Highest levels found in urine, but also relatively abundant in semen and saliva.
  • Sequence similarities

    Belongs to the DNase I family.
  • Cellular localization

    Secreted. Nucleus envelope. Secretory protein, stored in zymogen granules and found in the nuclear envelope.
  • Information by UniProt
  • Database links

  • Alternative names

    • Deoxyribonuclease 1 antibody
    • Deoxyribonuclease I antibody
    • Deoxyribonuclease-1 antibody
    • Deoxyribonuclease1 antibody
    • DeoxyribonucleaseI antibody
    • DNAS1_HUMAN antibody
    • DNASE 1 antibody
    • DNase I antibody
    • DNase I lysosomal antibody
    • DNASE1 antibody
    • DNaseI antibody
    • DNL 1 antibody
    • DNL1 antibody
    • Dornase alfa antibody
    • DRNI antibody
    • FLJ38093 antibody
    • Human urine deoxyribonuclease I antibody
    see all

Images

  • Paraffin-embedded human ovarian cancer tissue stained for DNase I using ab224617 at 1/100 dilution in immunohistochemical analysis.

  • Anti-DNase I antibody (ab224617) at 1/500 dilution + Mouse brain tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 31 kDa
    Observed band size: 32 kDa
    why is the actual band size different from the predicted?

References

ab224617 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224617.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up