Anti-DNASE2 antibody (ab168782)
Key features and details
- Mouse polyclonal to DNASE2
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DNASE2 antibody
See all DNASE2 primary antibodies -
Description
Mouse polyclonal to DNASE2 -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human DNASE2 aa 1-360.
Sequence:MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQ YKYLDESSGGWRDGRALINSPEGAVGRSLQPLYRSNTSQLAFLLYNDQPP QPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPASSAAYSWPHSA CTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENV VKGHHVSQEPWNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTN LQVQFWHKTVGILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCV SPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGM ARKPSRAYKI
Database link: NP_001366.1 -
Positive control
- Lysate from DNASE2 transfected 293T cells; HeLa cells
-
General notes
This product was previously labelled as DNase II
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab168782 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. | |
| ICC/IF | Use a concentration of 10 µg/ml. |
Target
-
Function
Hydrolyzes DNA under acidic conditions with a preference for double-stranded DNA. Plays a major role in the degradation of nuclear DNA in cellular apoptosis during development. Necessary for proper fetal development and for definitive erythropoiesis in fetal liver, where it degrades nuclear DNA expelled from erythroid precursor cells. -
Sequence similarities
Belongs to the DNase II family. -
Post-translational
modificationsGlycosylated. Mutations that eliminate N-glycosylation sites reduce activity, but enzymatic deglycosylation has no effect. -
Cellular localization
Lysosome. - Information by UniProt
-
Database links
- Entrez Gene: 1777 Human
- Omim: 126350 Human
- SwissProt: O00115 Human
- Unigene: 118243 Human
-
Alternative names
- Acid DNase antibody
- Deoxyribonuclease 2 alpha antibody
- Deoxyribonuclease 2 antibody
see all
Images
-
Western blot - Anti-DNASE2 antibody (ab168782)All lanes : Anti-DNASE2 antibody (ab168782) at 1 µg/ml
Lane 1 : DNASE2 transfected 293T cell lysate
Lane 2 : Non transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Predicted band size: 40 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-DNASE2 antibody (ab168782)Immunofluorescence analysis of paraformaldehyde-fixed HeLa cells, labeling DNASE2 using ab168782 at 10 µg/ml. Cells should be permeabilized by incubating for 15 minutes on ice with 2 mL of 0.1% Triton X-100 in PBS prior to staining.
Protocols
Datasheets and documents
References (1)
ab168782 has been referenced in 1 publication.
- Lazzaretto B & Fadeel B Intra- and Extracellular Degradation of Neutrophil Extracellular Traps by Macrophages and Dendritic Cells. J Immunol 203:2276-2290 (2019). PubMed: 31519860
