Overview

  • Product name

    Anti-dNT-2 antibody
  • Description

    Rabbit polyclonal to dNT-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human dNT-2 aa 38-228. Expressed in E.coli.
    Sequence:

    VLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPG LSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFK YCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTP SWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC


    Database link: Q9NPB1

  • Positive control

    • IHC-P: Human brain tissue. WB: Mouse cerebrum lysate; Recombinant human dNT-2 protein.
  • General notes

    Previously labelled as NT5M. 

Properties

Applications

Our Abpromise guarantee covers the use of ab231053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 26 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Dephosphorylates specifically the 5' and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides, and so protects mitochondrial DNA replication from excess dTTP. Has only marginal activity towards dIMP and dGMP.
  • Tissue specificity

    Highly expressed in heart, brain and skeletal muscle. Detected at very low levels in kidney and pancreas.
  • Sequence similarities

    Belongs to the 5'(3')-deoxyribonucleotidase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3''-nucleotidase antibody
    • 5'' antibody
    • 5''(3'')-deoxyribonucleotidase antibody
    • 5'(3')-deoxyribonucleotidase, mitochondrial antibody
    • 5',3'-nucleotidase, mitochondrial antibody
    • Deoxy-5''-nucleotidase 2 antibody
    • dNT-2 antibody
    • DNT2 antibody
    • mitochondrial antibody
    • NT5M antibody
    • NT5M_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human brain tissue stained for dNT-2 using ab231053 at 20 µg/ml in immunohistochemical analysis, followed by DAB staining.

  • Anti-dNT-2 antibody (ab231053) at 2 µg/ml + Mouse cerebrum lysate

    Predicted band size: 26 kDa

  • Anti-dNT-2 antibody (ab231053) at 2 µg/ml + Recombinant human dNT-2 protein

    Predicted band size: 26 kDa

References

ab231053 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up