Anti-DNTTIP1/TDIF1 antibody (ab174663)
Key features and details
- Rabbit polyclonal to DNTTIP1/TDIF1
- Suitable for: IP, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DNTTIP1/TDIF1 antibody
See all DNTTIP1/TDIF1 primary antibodies -
Description
Rabbit polyclonal to DNTTIP1/TDIF1 -
Host species
Rabbit -
Tested applications
Suitable for: IP, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow, Orangutan -
Immunogen
Synthetic peptide within Human DNTTIP1/TDIF1 aa 279-329. The exact sequence is proprietary. NP_443183.1
Sequence:ASDDYRGCLDLKLEELKSFVLPSWMVEKMRKYMETLRTENEHRAVEAPPQ T
Database link: Q9H147 -
Positive control
- Whole cell lysate from HeLa, 293T and Jurkat cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab174663 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IP |
Use at 2-10 µg/mg of lysate.
|
|
WB |
1/2000 - 1/10000. Predicted molecular weight: 37 kDa.
|
Notes |
---|
IP
Use at 2-10 µg/mg of lysate. |
WB
1/2000 - 1/10000. Predicted molecular weight: 37 kDa. |
Target
-
Function
Shown to enhance TdT activity, in vitro. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 116092 Human
- Omim: 611388 Human
- SwissProt: A6H7A8 Cow
- SwissProt: Q9H147 Human
- SwissProt: Q5R595 Orangutan
- Unigene: 472852 Human
-
Alternative names
- C20orf167 antibody
- Deoxynucleotidyltransferase terminal interacting protein 1 antibody
- Deoxynucleotidyltransferase terminal-interacting protein 1 antibody
see all
Images
-
Detection of DNTTIP1/TDIF1 by Western Blot of Immunoprecipitate.
-
All lanes : Anti-DNTTIP1/TDIF1 antibody (ab174663) at 0.100000001490116 µg/ml
Lane 1 : HeLa whole cell lysate
Lane 2 : 293T whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 37 kDa
Exposure time: 3 minutes
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab174663 has been referenced in 1 publication.
- Turnbull RE et al. The MiDAC histone deacetylase complex is essential for embryonic development and has a unique multivalent structure. Nat Commun 11:3252 (2020). PubMed: 32591534