Overview

  • Product name

    Anti-DNTTIP1/TDIF1 antibody
    See all DNTTIP1/TDIF1 primary antibodies
  • Description

    Rabbit polyclonal to DNTTIP1/TDIF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human DNTTIP1/TDIF1 aa 1-329. (NP_443183.1).
    Sequence:

    MGATGDAEQPRGPSGAERGGLELGDAGAAGQLVLTNPWNIMIKHRQVQRR GRRSQMTTSFTDPAISMDLLRAVLQPSINEEIQTVFNKYMKFFQKAALNV RDNVGEEVDAEQLIQEACRSCLEQAKLLFSDGEKVIPRLTHELPGIKRGR QAEEECAHRGSPLPKKRKGRPPGHILSSDRAAAGMVWKPKSCEPIRREGP KWDPARLNESTTFVLGSRANKALGMGGTRGRIYIKHPHLFKYAADPQDKH WLAEQHHMRATGGKMAYLLIEEDIRDLAASDDYRGCLDLKLEELKSFVLP SWMVEKMRKYMETLRTENEHRAVEAPPQT


    Database link: Q9H147

  • Positive control

    • Human small intestine tissue.
  • General notes

     This product was previously labelled as DNTTIP1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab211284 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml.
WB Use at an assay dependent concentration. Predicted molecular weight: 37 kDa.

Target

  • Function

    Shown to enhance TdT activity, in vitro.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • C20orf167 antibody
    • Deoxynucleotidyltransferase terminal interacting protein 1 antibody
    • Deoxynucleotidyltransferase terminal-interacting protein 1 antibody
    • dJ447F3.4 antibody
    • DNTTIP1 antibody
    • TdIF 1 antibody
    • TdIF1 antibody
    • TDIF1_HUMAN antibody
    • TdT binding protein antibody
    • TdT interacting factor 1 antibody
    • TdT-interacting factor 1 antibody
    • Terminal deoxynucleotidyltransferase interacting factor 1 antibody
    • Terminal deoxynucleotidyltransferase-interacting factor 1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human small intestine tissue labeling DNTTIP1/TDIF1 with ab211284 at 10 µg/ml.

References

ab211284 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211284.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up