Overview

  • Product name

  • Description

    Rabbit polyclonal to DOC2B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human DOC2B aa 7-180.
    Sequence:

    GEKATISIQEHMAIDVCPGPIRPIKQISDYFPRFPRGLPPDAGPRAAAPP DAPARPAVAGAGRRSPSDGAREDDEDVDQLFGAYGSSPGPSPGPSPARPP AKPPEDEPDADGYESDDCTALGTLDFSLLYDQENNALHCTITKAKGLKPM DHNGLADPYVKLHLLPGASKANKL


    Database link: Q14184

  • Positive control

    • IHC-P: Human placenta tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Calcium sensor which positively regulates SNARE-dependent fusion of vesicles with membranes. Binds phospholipids in a calcium-dependent manner and may act at the priming stage of fusion by modifying membrane curvature to stimulate fusion. Involved in calcium-triggered exocytosis in chromaffin cells and calcium-dependent spontaneous release of neurotransmitter in absence of action potentials in neuronal cells. Involved both in glucose-stimulated insulin secretion in pancreatic cells and insulin-dependent GLUT4 transport to the plasma membrane in adipocytes.
  • Tissue specificity

    Widely expressed with highest levels in brain and kidney. Expressed in pancreatic islet cells (at protein level).
  • Sequence similarities

    Contains 2 C2 domains.
  • Domain

    C2 domain 1 is involved in binding calcium and phospholipids. C2 domain 2 may also play a role in the calcium-dependent targeting to membranes.
  • Cellular localization

    Cytoplasm. Cytoplasmic granule. Cell membrane. Translocates to the plasma membrane in a calcium-dependent manner.
  • Information by UniProt
  • Database links

  • Alternative names

    • Doc2 beta antibody
    • Doc2-beta antibody
    • Doc2b antibody
    • DOC2B_HUMAN antibody
    • DOC2BL antibody
    • Double C2 like domain containing protein beta antibody
    • Double C2 like domains beta antibody
    • Double C2 like domains beta like antibody
    • Double C2-like domain-containing protein beta antibody
    • OTTMUSP00000006522 antibody
    • RP23 78H4.2 antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for DOC2B using ab234643 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 cells (Human liver hepatocellular carcinoma cell line) cells stained for DOC2B (green) using ab234643 at 1/100 dilution in ICC/IF, followed by Alexa-Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234643 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up