Overview

  • Product name

  • Description

    Rabbit polyclonal to DOCK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human DOCK2 aa 500-550 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    EDMQRIHLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGTTLHDGFHDL V


    Database link: Q92608

  • Positive control

    • Mouse intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

Target

  • Relevance

    DOCK2 (dedicator of cytokinesis 2) is a hematopoietic cell-specific protein that participates in the cytoskeletal rearrangements required for lymphocyte migration in response to chemokines. DOCK2 activates the small GTPases RAC1 and RAC2 and may also be involved in IL2 transcriptional activation via the activation of RAC2.
  • Cellular localization

    Intracytoplasmic membrane. Peripheral membrane protein. Note=Colocalizes with F-actin.
  • Database links

  • Alternative names

    • Dedicator of cyto kinesis 2 antibody
    • Dedicator of cytokinesis 2 antibody
    • Dedicator of cytokinesis protein 2 antibody
    • DOCK 2 antibody
    • FLJ46592 antibody
    • IMD40 antibody
    • KIAA0209 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed and paraffin embedded mouse intestine labeling DOCK2 using ab203068 at 1/200 dilution. DAB staining.

References

ab203068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203068.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up