Overview

  • Product name

  • Description

    Rabbit polyclonal to DOCK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human DOCK2 aa 1746-1826.
    Sequence:

    SVLSQMSFASQSMPTIPALALSVAGIPGLDEANTSPRLSQTFLQLSDGDK KTLTRKKVNQFFKTMLASKSAEEGKQIPDSL


    Database link: Q92608

  • Positive control

    • Human lymph node tissue and U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    DOCK2 (dedicator of cytokinesis 2) is a hematopoietic cell-specific protein that participates in the cytoskeletal rearrangements required for lymphocyte migration in response to chemokines. DOCK2 activates the small GTPases RAC1 and RAC2 and may also be involved in IL2 transcriptional activation via the activation of RAC2.
  • Cellular localization

    Intracytoplasmic membrane. Peripheral membrane protein. Note=Colocalizes with F-actin.
  • Database links

  • Alternative names

    • Dedicator of cyto kinesis 2 antibody
    • Dedicator of cytokinesis 2 antibody
    • Dedicator of cytokinesis protein 2 antibody
    • DOCK 2 antibody
    • FLJ46592 antibody
    • IMD40 antibody
    • KIAA0209 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Human lymph node tissue, labeling DOCK2 with ab204372 at 1/200 dilution. 

  • Immunofluorescence analysis of PFA-fixed, Triton X-100 permeabilized U-251 MG cells, labeling DOCK2 (green) with ab204372 at 4 µg/ml.

References

ab204372 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up