Overview

  • Product name

  • Description

    Rabbit Polyclonal to DOCK9/Trg
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human DOCK9 aa 280-357.
    Sequence:

    LQLNFEAAMQEKRNGDSHEDDEQSKLEGSGSGLDSYLPELAKSAREAEIK LKSESRVKLFYLDPDAQKLDFSSAEPEV


    Database link: Q9BZ29

  • Positive control

    • Human cerebellum tissue; A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Guanine nucleotide-exchange factor (GEF) that activates CDC42 by exchanging bound GDP for free GTP. Overexpression induces filopodia formation.
  • Tissue specificity

    Widely expressed, with highest expression in heart and placenta. Expressed at intermediate level in kidney, brain, lung and skeletal muscle.
  • Sequence similarities

    Belongs to the DOCK family.
    Contains 1 DHR-1 domain.
    Contains 1 DHR-2 domain.
    Contains 1 PH domain.
  • Domain

    The DHR-2 domain is necessary and sufficient for the GEF activity.
  • Cellular localization

    Endomembrane system. Associated with membranes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cdc42 guanine nucleotide exchange factor zizimin 1 antibody
    • Cdc42 guanine nucleotide exchange factor zizimin-1 antibody
    • Dedicator of cytokinesis protein 9 antibody
    • DKFZp686C11110 antibody
    • DKFZp686D2047 antibody
    • DKFZp686N04132 antibody
    • DOCK 9 antibody
    • DOCK9 antibody
    • DOCK9_HUMAN antibody
    • FLJ16744 antibody
    • FLJ44528 antibody
    • FLJ45282 antibody
    • FLJ45601 antibody
    • KIAA1058 antibody
    • KIAA1085 antibody
    • ZIZ1 antibody
    • Zizimin1 antibody
    see all

Images

  • Immunofluorescent analysis of A431 cells labeling DOCK9 with ab204421 at 4 µg/mL, Goat anti rabbit IgG (Alexa Fluor® 488) (ab150077) at 1/800 and DAPI staining (blue).

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human cerebellum tissue labeling DOCK9 with ab204421 at 1/500.

References

ab204421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up