Overview

  • Product name
  • Description
    Rabbit polyclonal to DOK4
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human DOK4 aa 1-326.
    Sequence:

    MATNFSDIVKQGYVKMKSRKLGIYRRCWLVFRKSSSKGPQRLEKYPDEKS VCLRGCPKVTEISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSELEA EEWYKTLSVECLGSRLNDISLGEPDLLAPGVQCEQTDRFNVFLLPCPNLD VYGECKLQITHENIYLWDIHNPRVKLVSWPLCSLRRYGRDATRFTFEAGR MCDAGEGLYTFQTQEGEQIYQRVHSATLAIAEQHKRVLLEMEKNVRLLNK GTEHYSYPCTPTTMLPRSAYWHHITGSQNIAEASSYAGEGYGAAQASSET DLLNRFILLKPKPSQGDSSEAKTPSQ


    Database link: Q8TEW6

  • Positive control
    • MCF7 cell lysate, Human prostate cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab175624 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 37 kDa.

Target

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of mouse kidney tissue labelling DOK4 with ab175624 at 1/200. Magnification: 200x.
  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175624. Blue DAPI for nuclear staining.
  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human prostate cancer tissue, labeling DOK4 using ab175624 at a 1/50 dilution.

References

ab175624 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Loading amount
20 µg
Gel Running Conditions
Reduced Denaturing (4-12%)
Sample
Zebrafish Tissue lysate - whole (whole embryos)
Specification
whole embryos
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Dr. Evgenia Salta

Verified customer

Submitted Feb 05 2015

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up