Overview

  • Product name

    Anti-DOPA Decarboxylase/DDC antibody
    See all DOPA Decarboxylase/DDC primary antibodies
  • Description

    Rabbit polyclonal to DOPA Decarboxylase/DDC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Cow, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human DOPA Decarboxylase/DDC aa 200-420. Two N-terminal tags.Expressed in E.coli.
    Sequence:

    LIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCC SFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNF NPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHW QIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFE ICVEVILGLVCFRLKGSNKVN


    Database link: P20711-1

  • Positive control

    • WB: Recombinant human DOPA Decarboxylase/DDC protein; Cow kidney lysate. IHC-P: Human lung tissue.
  • General notes

    Previously labelled as DOPA Decarboxylase.

Properties

Applications

Our Abpromise guarantee covers the use of ab233132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 54 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
  • Pathway

    Catecholamine biosynthesis; dopamine biosynthesis; dopamine from L-tyrosine: step 2/2.
  • Involvement in disease

    Defects in DDC are the cause of aromatic L-amino-acid decarboxylase deficiency (AADCD) [MIM:608643]. AADCD deficiency is an inborn error in neurotransmitter metabolism that leads to combined serotonin and catecholamine deficiency. It causes developmental and psychomotor delay, poor feeding, lethargy, ptosis, intermittent hypothermia, gastrointestinal disturbances. The onset is early in infancy and inheritance is autosomal recessive.
  • Sequence similarities

    Belongs to the group II decarboxylase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • AADC antibody
    • Aromatic L Amino Acid Decarboxylase antibody
    • Aromatic-L-amino-acid decarboxylase antibody
    • DDC antibody
    • DDC_HUMAN antibody
    • DOPA decarboxylase (aromatic L-amino acid decarboxylase) antibody
    • DOPA decarboxylase antibody
    see all

Images

  • Anti-DOPA Decarboxylase/DDC antibody (ab233132) at 2 µg/ml + Recombinant human DOPA Decarboxylase/DDC protein

    Predicted band size: 54 kDa

  • Anti-DOPA Decarboxylase/DDC antibody (ab233132) at 2 µg/ml + Cow kidney tissue lysate

    Predicted band size: 54 kDa

  • Anti-DOPA Decarboxylase/DDC antibody (ab233132) at 2 µg/ml + Cow kidney tissue lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution

    Predicted band size: 54 kDa

  • Formalin-fixed, paraffin-embedded human lung tissue stained for DOPA Decarboxylase/DDC using ab233132 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233132 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up