Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)

Submit a review Submit a question References (1)

Key features and details

  • Mouse monoclonal [CL2962] to DOPA Decarboxylase/DDC
  • Suitable for: WB, IHC-P, ICC/IF
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG1

Overview

  • Product name

    Anti-DOPA Decarboxylase/DDC antibody [CL2962]
    See all DOPA Decarboxylase/DDC primary antibodies

  • Description

    Mouse monoclonal [CL2962] to DOPA Decarboxylase/DDC

  • Host species

    Mouse

  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details

  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Pig, Drosophila melanogaster

  • Immunogen

    Recombinant fragment corresponding to Human DOPA Decarboxylase/DDC aa 114-221.
    Sequence:

    LETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKV IHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDG NFAMRASA


    Database link: P20711

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Epitope

    Binds to an epitope located within the peptide sequence MDWLGKMLEL (aa 119-128) as determined by overlapping synthetic peptides.

  • Positive control

    • IHC: ; Rat substantia nigra, mouse substantia nigra and human substantia nigra tissues. WB: Human kidney tissue lysate ICC/IF: Rat substantia nigra tissue

  • General notes

    Previously labelled as DOPA Decarboxylase.

Properties

Applications

Our Abpromise guarantee covers the use of ab211535 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 53 kDa.
IHC-P 1/1000 - 1/2500.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    Catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.

  • Pathway

    Catecholamine biosynthesis; dopamine biosynthesis; dopamine from L-tyrosine: step 2/2.

  • Involvement in disease

    Defects in DDC are the cause of aromatic L-amino-acid decarboxylase deficiency (AADCD) [MIM:608643]. AADCD deficiency is an inborn error in neurotransmitter metabolism that leads to combined serotonin and catecholamine deficiency. It causes developmental and psychomotor delay, poor feeding, lethargy, ptosis, intermittent hypothermia, gastrointestinal disturbances. The onset is early in infancy and inheritance is autosomal recessive.

  • Sequence similarities

    Belongs to the group II decarboxylase family.
  • Information by UniProt

  • Database links

    see all

  • Alternative names

    • AADC antibody
    • Aromatic L Amino Acid Decarboxylase antibody
    • Aromatic-L-amino-acid decarboxylase antibody
    • DDC antibody
    • DDC_HUMAN antibody
    • DOPA decarboxylase (aromatic L-amino acid decarboxylase) antibody
    • DOPA decarboxylase antibody
    see all

Images

  • Western blot - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)
    Western blot - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)
    Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535) at 1/500 dilution + Human kidney tissue lysate

    Predicted band size: 53 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)

    Immunohistochemical analysis of human kidney tissue staining DDC with ab211535 at 1/1000 dilution.

  • Immunocytochemistry/ Immunofluorescence - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)
    Immunocytochemistry/ Immunofluorescence - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)

    Immunocytochemistry/Immunofluorescent analysis of rat substantia nigra cells staining DOPA Decarboxylase with ab211535.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)

    Immunohistochemical analysis of paraffin-embedded human substantia nigra tissue labeling DOPA Decarboxylase/DDC with ab211535 at 1/1000 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)

    Immunohistochemical analysis of human fallopian tube tissue staining DDC with ab211535 at 1/1000 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)

    Immunohistochemical analysis of paraffin-embedded mouse substantia nigra tissue labeling DOPA Decarboxylase/DDC with ab211535 at 1/1000 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DOPA Decarboxylase/DDC antibody [CL2962] (ab211535)

    Immunohistochemical analysis of paraffin-embedded rat substantia nigra tissue labeling DOPA Decarboxylase/DDC with ab211535 at 1/1000 dilution.

References (1)

Publishing research using ab211535? Please let us know so that we can cite the reference in this datasheet.

ab211535 has been referenced in 1 publication.

  • Kim H  et al. Modeling G2019S-LRRK2 Sporadic Parkinson's Disease in 3D Midbrain Organoids. Stem Cell Reports 12:518-531 (2019). PubMed: 30799274

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab211535.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com