Overview

  • Product name

    Anti-Dopamine Transporter antibody
    See all Dopamine Transporter primary antibodies
  • Description

    Rabbit polyclonal to Dopamine Transporter
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Dopamine Transporter aa 578-620 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    YKFCSLPGSFREKLAYAIAPEKDRELVDRGEVRQFTLRHWLKV


    Database link: Q01959

  • Positive control

    • Rat kidney tissue; RSC96 cells

Properties

Applications

Our Abpromise guarantee covers the use of ab214470 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/20 - 1/100.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Block endogenous peroxidase by 3% hydrogen peroxide for 20 minutes

Target

  • Function

    Amine transporter. Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals.
  • Involvement in disease

    Defects in SLC6A3 are the cause of dystonia-parkinsonism infantile (DYTPRI) [MIM:613135]. It is a neurodegenerative disorder characterized by infantile onset of parkinsonism and dystonia. Other neurologic features include global developmental delay, bradikinesia and pyramidal tract signs.
  • Sequence similarities

    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A3 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DA transporter antibody
    • DAT 1 antibody
    • DAT antibody
    • DAT1 antibody
    • Dopamine transporter 1 antibody
    • Dopamine transporter antibody
    • PKDYS antibody
    • SC6A3_HUMAN antibody
    • SLC6A3 antibody
    • Sodium dependent dopamine transporter antibody
    • Sodium-dependent dopamine transporter antibody
    • Solute carrier family 6 (neurotransmitter transporter dopamine), member 3 antibody
    • Solute carrier family 6 (neurotransmitter transporter), member 3 antibody
    • Solute carrier family 6 member 3 antibody
    • Variable number tandem repeat (VNTR) antibody
    see all

Images

  • Flow Cytometric analysis of RSC96 cells labeling Dopamine Transporter using ab214470 at 6 µg for 30 minutes followed by incubation with Goat Anti-Rabbit IgG FITC conjugated secondary (green) compared to control cells (blue), secondary only (light blue) and isotype control (orange).

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat kidney tissue labeling Dopamine Transporter with ab214470 at 1/400 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab214470 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
ELISA
Sample
Human Recombinant protein (Recombinant Human Dopamine Transporter protein (ab)
Specification
Recombinant Human Dopamine Transporter protein (ab
Blocking step
MSD block as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 20°C
Type
Direct

Abcam user community

Verified customer

Submitted Oct 16 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up